Mirror/zeek
1
0
Fork 0
mirror of https://github.com/zeek/zeek.git synced 2025-10-10 02:28:21 +00:00
Code Issues Projects Releases Packages Wiki Activity Actions 3

Merge remote-tracking branch 'origin/master' into topic/johanna/openflow

Browse source
This commit is contained in:
Johanna Amann 2015-07-08 12:15:09 -07:00
commit eb9fbd1258
93 changed files with 1289 additions and 544 deletions
Download patch file Download diff file Expand all files Collapse all files

104
CHANGES
View file

@ -1,4 +1,108 @@
2.4-20 | 2015-07-03 10:40:21 -0700
* Adding a weird for when truncated packets lead TCP reassembly to
ignore content. (Robin Sommer)
2.4-19 | 2015-07-03 09:04:54 -0700
* A set of tests exercising IP defragmentation and TCP reassembly.
(Robin Sommer)
2.4-17 | 2015-06-28 13:02:41 -0700
* BIT-1314: Add detection for Quantum Insert attacks. The TCP
reassembler can now keep a history of old TCP segments using the
tcp_max_old_segments option. An overlapping segment with different
data will then generate an rexmit_inconsistency event. The default
for tcp_max_old_segments is zero, which disabled any additional
buffering. (Yun Zheng Hu/Robin Sommer)
2.4-14 | 2015-06-28 12:30:12 -0700
* BIT-1400: Allow '<' and '>' in MIME multipart boundaries. The spec
doesn't actually seem to permit these, but they seem to occur in
the wild. (Jon Siwek)
2.4-12 | 2015-06-28 12:21:11 -0700
* BIT-1399: Trying to decompress deflated HTTP content even when
zlib headers are missing. (Seth Hall)
2.4-10 | 2015-06-25 07:11:17 -0700
* Correct a name used in a header identifier (Justin Azoff)
2.4-8 | 2015-06-24 07:50:50 -0700
* Restore the --load-seeds cmd-line option and enable the short
options -G/-H for --load-seeds/--save-seeds. (Daniel Thayer)
2.4-6 | 2015-06-19 16:26:40 -0700
* Generate protocol confirmations for Modbus, making it appear as a
confirmed service in conn.log. (Seth Hall)
* Put command line options in alphabetical order. (Daniel Thayer)
* Removing dead code for no longer supported -G switch. (Robin
Sommer) (Robin Sommer)
2.4 | 2015-06-09 07:30:53 -0700
* Release 2.4.
* Fixing tiny thing in NEWS. (Robin Sommer)
2.4-beta-42 | 2015-06-08 09:41:39 -0700
* Fix reporter errors with GridFTP traffic. (Robin Sommer)
2.4-beta-40 | 2015-06-06 08:20:52 -0700
* PE Analyzer: Change how we calculate the rva_table size. (Vlad Grigorescu)
2.4-beta-39 | 2015-06-05 09:09:44 -0500
* Fix a unit test to check for Broker requirement. (Jon Siwek)
2.4-beta-38 | 2015-06-04 14:48:37 -0700
* Test for Broker termination. (Robin Sommer)
2.4-beta-37 | 2015-06-04 07:53:52 -0700
* BIT-1408: Improve I/O loop and Broker IOSource. (Jon Siwek)
2.4-beta-34 | 2015-06-02 10:37:22 -0700
* Add signature support for F4M files. (Seth Hall)
2.4-beta-32 | 2015-06-02 09:43:31 -0700
* A larger set of documentation updates, fixes, and extentions.
(Daniel Thayer)
2.4-beta-14 | 2015-06-02 09:16:44 -0700
* Add memleak btest for attachments over SMTP. (Vlad Grigorescu)
* BIT-1410: Fix flipped tx_hosts and rx_hosts in files.log. Reported
by Ali Hadi. (Vlad Grigorescu)
* Updating the Mozilla root certs. (Seth Hall)
* Updates for the urls.bro script. Fixes BIT-1404. (Seth Hall)
2.4-beta-6 | 2015-05-28 13:20:44 -0700
* Updating submodule(s).
2.4-beta-2 | 2015-05-26 08:58:37 -0700
* Fix segfault when DNS is not available. Addresses BIT-1387. (Frank
Meier and Robin Sommer)
2.4-beta | 2015-05-07 21:55:31 -0700
* Release 2.4-beta.

2
COPYING
View file

@ -1,4 +1,4 @@
Copyright (c) 1995-2013, The Regents of the University of California
Copyright (c) 1995-2015, The Regents of the University of California
through the Lawrence Berkeley National Laboratory and the
International Computer Science Institute. All rights reserved.

4
NEWS
View file

@ -4,8 +4,8 @@ release. For an exhaustive list of changes, see the ``CHANGES`` file
(note that submodules, such as BroControl and Broccoli, come with
their own ``CHANGES``.)
Bro 2.4 (in progress)
=====================
Bro 2.4
=======
New Functionality
-----------------

2
VERSION
View file

@ -1 +1 @@
2.4-beta
2.4-20

2
aux/bro-aux

@ -1 +1 @@
Subproject commit a2d290a832c35ad11f3fabb19812bcae2ff089cd
Subproject commit 6d6679506d8762ddbba16f0b34f7ad253e3aac45

2
aux/broctl

@ -1 +1 @@
Subproject commit 97c17d21725e42b36f4b49579077ecdc28ddb86a
Subproject commit 54377d4746e2fd3ba7b7ca97e4a6ceccbd2cc236

2
aux/broker

@ -1 +1 @@
Subproject commit b02fefd5cf78c1576e59c106f5211ce5ae47cfdd
Subproject commit f303cdbc60ad6eef35ebcd1473ee85b3123f5ef1

2
aux/btest

@ -1 +1 @@
Subproject commit 80b42ee3e4503783b6720855b28e83ff1658c22b
Subproject commit 0e2da116a5e29baacaecc6daac7bc4bc9ff387c5

2
aux/plugins

@ -1 +1 @@
Subproject commit e1ea9f67cfe3d6a81e0c1479ced0b9aa73e77c87
Subproject commit 99d7519991b41a970809a99433ea9c7df42e9d93

1
doc/components/bro-plugins/README.rst Symbolic link
View file

@ -0,0 +1 @@
../../../aux/plugins/README

1
doc/components/bro-plugins/dataseries/README.rst Symbolic link
View file

@ -0,0 +1 @@
../../../../aux/plugins/dataseries/README

1
doc/components/bro-plugins/elasticsearch/README.rst Symbolic link
View file

@ -0,0 +1 @@
../../../../aux/plugins/elasticsearch/README

1
doc/components/bro-plugins/netmap/README.rst Symbolic link
View file

@ -0,0 +1 @@
../../../../aux/plugins/netmap/README

1
doc/components/index.rst
View file

@ -21,6 +21,7 @@ current, independent component releases.
Broker - User Manual <broker/broker-manual.rst>
BroControl - Interactive Bro management shell <broctl/README>
Bro-Aux - Small auxiliary tools for Bro <bro-aux/README>
Bro-Plugins - A collection of plugins for Bro <bro-plugins/README>
BTest - A unit testing framework <btest/README>
Capstats - Command-line packet statistic tool <capstats/README>
PySubnetTree - Python module for CIDR lookups<pysubnettree/README>

62
doc/devel/plugins.rst
View file

@ -3,7 +3,7 @@
Writing Bro Plugins
===================
Bro internally provides plugin API that enables extending
Bro internally provides a plugin API that enables extending
the system dynamically, without modifying the core code base. That way
custom code remains self-contained and can be maintained, compiled,
and installed independently. Currently, plugins can add the following
@ -32,7 +32,7 @@ Quick Start
===========
Writing a basic plugin is quite straight-forward as long as one
follows a few conventions. In the following we walk a simple example
follows a few conventions. In the following we create a simple example
plugin that adds a new built-in function (bif) to Bro: we'll add
``rot13(s: string) : string``, a function that rotates every character
in a string by 13 places.
@ -81,7 +81,7 @@ The syntax of this file is just like any other ``*.bif`` file; we
won't go into it here.
Now we can already compile our plugin, we just need to tell the
configure script that ``init-plugin`` put in place where the Bro
configure script (that ``init-plugin`` created) where the Bro
source tree is located (Bro needs to have been built there first)::
# cd rot13-plugin
@ -99,7 +99,7 @@ option::
# export BRO_PLUGIN_PATH=/path/to/rot13-plugin/build
# bro -N
[...]
Plugin: Demo::Rot13 - <Insert brief description of plugin> (dynamic, version 1)
Demo::Rot13 - <Insert description> (dynamic, version 0.1)
[...]
That looks quite good, except for the dummy description that we should
@ -108,28 +108,30 @@ is about. We do this by editing the ``config.description`` line in
``src/Plugin.cc``, like this::
[...]
plugin::Configuration Configure()
plugin::Configuration Plugin::Configure()
{
plugin::Configuration config;
config.name = "Demo::Rot13";
config.description = "Caesar cipher rotating a string's characters by 13 places.";
config.version.major = 1;
config.version.minor = 0;
config.version.major = 0;
config.version.minor = 1;
return config;
}
[...]
Now rebuild and verify that the description is visible::
# make
[...]
# bro -N | grep Rot13
Plugin: Demo::Rot13 - Caesar cipher rotating a string's characters by 13 places. (dynamic, version 1)
Demo::Rot13 - Caesar cipher rotating a string's characters by 13 places. (dynamic, version 0.1)
Better. Bro can also show us what exactly the plugin provides with the
Bro can also show us what exactly the plugin provides with the
more verbose option ``-NN``::
# bro -NN
[...]
Plugin: Demo::Rot13 - Caesar cipher rotating a string's characters by 13 places. (dynamic, version 1)
Demo::Rot13 - Caesar cipher rotating a string's characters by 13 places. (dynamic, version 0.1)
[Function] Demo::rot13
[...]
@ -157,10 +159,12 @@ The installed version went into
``<bro-install-prefix>/lib/bro/plugins/Demo_Rot13``.
One can distribute the plugin independently of Bro for others to use.
To distribute in source form, just remove the ``build/`` (``make
distclean`` does that) and then tar up the whole ``rot13-plugin/``
To distribute in source form, just remove the ``build/`` directory
(``make distclean`` does that) and then tar up the whole ``rot13-plugin/``
directory. Others then follow the same process as above after
unpacking. To distribute the plugin in binary form, the build process
unpacking.
To distribute the plugin in binary form, the build process
conveniently creates a corresponding tarball in ``build/dist/``. In
this case, it's called ``Demo_Rot13-0.1.tar.gz``, with the version
number coming out of the ``VERSION`` file that ``init-plugin`` put
@ -169,14 +173,14 @@ plugin, but no further source files. Optionally, one can include
further files by specifying them in the plugin's ``CMakeLists.txt``
through the ``bro_plugin_dist_files`` macro; the skeleton does that
for ``README``, ``VERSION``, ``CHANGES``, and ``COPYING``. To use the
plugin through the binary tarball, just unpack it and point
``BRO_PLUGIN_PATH`` there; or copy it into
``<bro-install-prefix>/lib/bro/plugins/`` directly.
plugin through the binary tarball, just unpack it into
``<bro-install-prefix>/lib/bro/plugins/``. Alternatively, if you unpack
it in another location, then you need to point ``BRO_PLUGIN_PATH`` there.
Before distributing your plugin, you should edit some of the meta
files that ``init-plugin`` puts in place. Edit ``README`` and
``VERSION``, and update ``CHANGES`` when you make changes. Also put a
license file in place as ``COPYING``; if BSD is fine, you find a
license file in place as ``COPYING``; if BSD is fine, you will find a
template in ``COPYING.edit-me``.
Plugin Directory Layout
@ -193,7 +197,7 @@ directory. With the skeleton, ``<base>`` corresponds to ``build/``.
must exist, and its content must consist of a single line with the
qualified name of the plugin (e.g., "Demo::Rot13").
``<base>/lib/<plugin-name>-<os>-<arch>.so``
``<base>/lib/<plugin-name>.<os>-<arch>.so``
The shared library containing the plugin's compiled code. Bro will
load this in dynamically at run-time if OS and architecture match
the current platform.
@ -215,8 +219,8 @@ directory. With the skeleton, ``<base>`` corresponds to ``build/``.
Any other files in ``<base>`` are ignored by Bro.
By convention, a plugin should put its custom scripts into sub folders
of ``scripts/``, i.e., ``scripts/<script-namespace>/<script>.bro`` to
avoid conflicts. As usual, you can then put a ``__load__.bro`` in
of ``scripts/``, i.e., ``scripts/<plugin-namespace>/<plugin-name>/<script>.bro``
to avoid conflicts. As usual, you can then put a ``__load__.bro`` in
there as well so that, e.g., ``@load Demo/Rot13`` could load a whole
module in the form of multiple individual scripts.
@ -242,7 +246,8 @@ as well as the ``__bro_plugin__`` magic file and any further
distribution files specified in ``CMakeLists.txt`` (e.g., README,
VERSION). You can find a full list of files installed in
``build/MANIFEST``. Behind the scenes, ``make install`` really just
copies over the binary tarball in ``build/dist``.
unpacks the binary tarball from ``build/dist`` into the destination
directory.
``init-plugin`` will never overwrite existing files. If its target
directory already exists, it will by default decline to do anything.
@ -369,18 +374,19 @@ Testing Plugins
===============
A plugin should come with a test suite to exercise its functionality.
The ``init-plugin`` script puts in place a basic </btest/README> setup
The ``init-plugin`` script puts in place a basic
:doc:`BTest <../../components/btest/README>` setup
to start with. Initially, it comes with a single test that just checks
that Bro loads the plugin correctly. It won't have a baseline yet, so
let's get that in place::
# cd tests
# btest -d
[ 0%] plugin.loading ... failed
[ 0%] rot13.show-plugin ... failed
% 'btest-diff output' failed unexpectedly (exit code 100)
% cat .diag
== File ===============================
Demo::Rot13 - Caesar cipher rotating a string's characters by 13 places. (dynamic, version 1.0)
Demo::Rot13 - Caesar cipher rotating a string's characters by 13 places. (dynamic, version 0.1)
[Function] Demo::rot13
== Error ===============================
@ -413,8 +419,8 @@ correctly::
Check the output::
# btest -d plugin/rot13.bro
[ 0%] plugin.rot13 ... failed
# btest -d rot13/bif-rot13.bro
[ 0%] rot13.bif-rot13 ... failed
% 'btest-diff output' failed unexpectedly (exit code 100)
% cat .diag
== File ===============================
@ -429,7 +435,7 @@ Check the output::
Install the baseline::
# btest -U plugin/rot13.bro
# btest -U rot13/bif-rot13.bro
all 1 tests successful
Run the test-suite::
@ -457,7 +463,7 @@ your plugin's debugging output with ``-B plugin-<name>``, where
``<name>`` is the name of the plugin as returned by its
``Configure()`` method, yet with the namespace-separator ``::``
replaced with a simple dash. Example: If the plugin is called
``Bro::Demo``, use ``-B plugin-Bro-Demo``. As usual, the debugging
``Demo::Rot13``, use ``-B plugin-Demo-Rot13``. As usual, the debugging
output will be recorded to ``debug.log`` if Bro's compiled in debug
mode.

4
doc/frameworks/logging-input-sqlite.rst
View file

@ -67,8 +67,8 @@ that are present in the ASCII log files::
'id.orig_p' integer,
...
Note that the ASCII ``conn.log`` will still be created. To disable the ASCII writer for a
log stream, you can remove the default filter:
Note that the ASCII ``conn.log`` will still be created. To prevent this file
from being created, you can remove the default filter:
.. code:: bro

648
doc/frameworks/logging.rst
View file

@ -19,195 +19,144 @@ Terminology
Bro's logging interface is built around three main abstractions:
Log streams
A stream corresponds to a single log. It defines the set of
fields that a log consists of with their names and fields.
Examples are the ``conn`` for recording connection summaries,
Streams
A log stream corresponds to a single log. It defines the set of
fields that a log consists of with their names and types.
Examples are the ``conn`` stream for recording connection summaries,
and the ``http`` stream for recording HTTP activity.
Filters
Each stream has a set of filters attached to it that determine
what information gets written out. By default, each stream has
one default filter that just logs everything directly to disk
with an automatically generated file name. However, further
filters can be added to record only a subset, split a stream
into different outputs, or to even duplicate the log to
multiple outputs. If all filters are removed from a stream,
all output is disabled.
one default filter that just logs everything directly to disk.
However, additional filters can be added to record only a subset
of the log records, write to different outputs, or set a custom
rotation interval. If all filters are removed from a stream,
then output is disabled for that stream.
Writers
A writer defines the actual output format for the information
being logged. At the moment, Bro comes with only one type of
writer, which produces tab separated ASCII files. In the
future we will add further writers, like for binary output and
direct logging into a database.
Each filter has a writer. A writer defines the actual output
format for the information being logged. The default writer is
the ASCII writer, which produces tab-separated ASCII files. Other
writers are available, like for binary output or direct logging
into a database.
Basics
======
There are several different ways to customize Bro's logging: you can create
a new log stream, you can extend an existing log with new fields, you
can apply filters to an existing log stream, or you can customize the output
format by setting log writer options. All of these approaches are
described in this document.
The data fields that a stream records are defined by a record type
specified when it is created. Let's look at the script generating Bro's
connection summaries as an example,
:doc:`/scripts/base/protocols/conn/main.bro`. It defines a record
:bro:type:`Conn::Info` that lists all the fields that go into
``conn.log``, each marked with a ``&log`` attribute indicating that it
is part of the information written out. To write a log record, the
script then passes an instance of :bro:type:`Conn::Info` to the logging
framework's :bro:id:`Log::write` function.
Streams
=======
By default, each stream automatically gets a filter named ``default``
that generates the normal output by recording all record fields into a
single output file.
In order to log data to a new log stream, all of the following needs to be
done:
In the following, we summarize ways in which the logging can be
customized. We continue using the connection summaries as our example
to work with.
- A :bro:type:`record` type must be defined which consists of all the
fields that will be logged (by convention, the name of this record type is
usually "Info").
- A log stream ID (an :bro:type:`enum` with type name "Log::ID") must be
defined that uniquely identifies the new log stream.
- A log stream must be created using the :bro:id:`Log::create_stream` function.
- When the data to be logged becomes available, the :bro:id:`Log::write`
function must be called.
Filtering
---------
To create a new output file for an existing stream, you can add a
new filter. A filter can, e.g., restrict the set of fields being
logged:
In the following example, we create a new module "Foo" which creates
a new log stream.
.. code:: bro
event bro_init()
module Foo;
export {
# Create an ID for our new stream. By convention, this is
# called "LOG".
redef enum Log::ID += { LOG };
# Define the record type that will contain the data to log.
type Info: record {
ts: time &log;
id: conn_id &log;
service: string &log &optional;
missed_bytes: count &log &default=0;
};
}
# Optionally, we can add a new field to the connection record so that
# the data we are logging (our "Info" record) will be easily
# accessible in a variety of event handlers.
redef record connection += {
# By convention, the name of this new field is the lowercase name
# of the module.
foo: Info &optional;
};
# This event is handled at a priority higher than zero so that if
# users modify this stream in another script, they can do so at the
# default priority of zero.
event bro_init() &priority=5
{
# Add a new filter to the Conn::LOG stream that logs only
# timestamp and originator address.
local filter: Log::Filter = [$name="orig-only", $path="origs", $include=set("ts", "id.orig_h")];
Log::add_filter(Conn::LOG, filter);
# Create the stream. This adds a default filter automatically.
Log::create_stream(Foo::LOG, [$columns=Info, $path="foo"]);
}
Note the fields that are set for the filter:
In the definition of the "Info" record above, notice that each field has the
:bro:attr:`&log` attribute. Without this attribute, a field will not appear in
the log output. Also notice one field has the :bro:attr:`&optional` attribute.
This indicates that the field might not be assigned any value before the
log record is written. Finally, a field with the :bro:attr:`&default`
attribute has a default value assigned to it automatically.
``name``
A mandatory name for the filter that can later be used
to manipulate it further.
``path``
The filename for the output file, without any extension (which
may be automatically added by the writer). Default path values
are generated by taking the stream's ID and munging it slightly.
:bro:enum:`Conn::LOG` is converted into ``conn``,
:bro:enum:`PacketFilter::LOG` is converted into
``packet_filter``, and :bro:enum:`Known::CERTS_LOG` is
converted into ``known_certs``.
``include``
A set limiting the fields to the ones given. The names
correspond to those in the :bro:type:`Conn::Info` record, with
sub-records unrolled by concatenating fields (separated with
dots).
Using the code above, you will now get a new log file ``origs.log``
that looks like this::
#separator \x09
#path origs
#fields ts id.orig_h
#types time addr
1128727430.350788 141.42.64.125
1128727435.450898 141.42.64.125
If you want to make this the only log file for the stream, you can
remove the default filter (which, conveniently, has the name
``default``):
At this point, the only thing missing is a call to the :bro:id:`Log::write`
function to send data to the logging framework. The actual event handler
where this should take place will depend on where your data becomes available.
In this example, the :bro:id:`connection_established` event provides our data,
and we also store a copy of the data being logged into the
:bro:type:`connection` record:
.. code:: bro
event bro_init()
event connection_established(c: connection)
{
# Remove the filter called "default".
Log::remove_filter(Conn::LOG, "default");
local rec: Foo::Info = [$ts=network_time(), $id=c$id];
# Store a copy of the data in the connection record so other
# event handlers can access it.
c$foo = rec;
Log::write(Foo::LOG, rec);
}
An alternate approach to "turning off" a log is to completely disable
the stream:
If you run Bro with this script, a new log file ``foo.log`` will be created.
Although we only specified four fields in the "Info" record above, the
log output will actually contain seven fields because one of the fields
(the one named "id") is itself a record type. Since a :bro:type:`conn_id`
record has four fields, then each of these fields is a separate column in
the log output. Note that the way that such fields are named in the log
output differs slightly from the way we would refer to the same field
in a Bro script (each dollar sign is replaced with a period). For example,
to access the first field of a ``conn_id`` in a Bro script we would use
the notation ``id$orig_h``, but that field is named ``id.orig_h``
in the log output.
.. code:: bro
When you are developing scripts that add data to the :bro:type:`connection`
record, care must be given to when and how long data is stored.
Normally data saved to the connection record will remain there for the
duration of the connection and from a practical perspective it's not
uncommon to need to delete that data before the end of the connection.
event bro_init()
{
Log::disable_stream(Conn::LOG);
}
If you want to skip only some fields but keep the rest, there is a
corresponding ``exclude`` filter attribute that you can use instead of
``include`` to list only the ones you are not interested in.
Add Fields to a Log
-------------------
A filter can also determine output paths *dynamically* based on the
record being logged. That allows, e.g., to record local and remote
connections into separate files. To do this, you define a function
that returns the desired path:
You can add additional fields to a log by extending the record
type that defines its content, and setting a value for the new fields
before each log record is written.
.. code:: bro
function split_log(id: Log::ID, path: string, rec: Conn::Info) : string
{
# Return "conn-local" if originator is a local IP, otherwise "conn-remote".
local lr = Site::is_local_addr(rec$id$orig_h) ? "local" : "remote";
return fmt("%s-%s", path, lr);
}
event bro_init()
{
local filter: Log::Filter = [$name="conn-split", $path_func=split_log, $include=set("ts", "id.orig_h")];
Log::add_filter(Conn::LOG, filter);
}
Running this will now produce two files, ``local.log`` and
``remote.log``, with the corresponding entries. One could extend this
further for example to log information by subnets or even by IP
address. Be careful, however, as it is easy to create many files very
quickly ...
.. sidebar:: A More Generic Path Function
The ``split_log`` method has one draw-back: it can be used
only with the :bro:enum:`Conn::LOG` stream as the record type is hardcoded
into its argument list. However, Bro allows to do a more generic
variant:
.. code:: bro
function split_log(id: Log::ID, path: string, rec: record { id: conn_id; } ) : string
{
return Site::is_local_addr(rec$id$orig_h) ? "local" : "remote";
}
This function can be used with all log streams that have records
containing an ``id: conn_id`` field.
While so far we have seen how to customize the columns being logged,
you can also control which records are written out by providing a
predicate that will be called for each log record:
.. code:: bro
function http_only(rec: Conn::Info) : bool
{
# Record only connections with successfully analyzed HTTP traffic
return rec$service == "http";
}
event bro_init()
{
local filter: Log::Filter = [$name="http-only", $path="conn-http", $pred=http_only];
Log::add_filter(Conn::LOG, filter);
}
This will result in a log file ``conn-http.log`` that contains only
traffic detected and analyzed as HTTP traffic.
Extending
---------
You can add further fields to a log stream by extending the record
type that defines its content. Let's say we want to add a boolean
field ``is_private`` to :bro:type:`Conn::Info` that indicates whether the
originator IP address is part of the :rfc:`1918` space:
Let's say we want to add a boolean field ``is_private`` to
:bro:type:`Conn::Info` that indicates whether the originator IP address
is part of the :rfc:`1918` space:
.. code:: bro
@ -218,9 +167,21 @@ originator IP address is part of the :rfc:`1918` space:
is_private: bool &default=F &log;
};
As this example shows, when extending a log stream's "Info" record, each
new field must always be declared either with a ``&default`` value or
as ``&optional``. Furthermore, you need to add the ``&log`` attribute
or otherwise the field won't appear in the log file.
Now we need to set the field. A connection's summary is generated at
the time its state is removed from memory. We can add another handler
Now we need to set the field. Although the details vary depending on which
log is being extended, in general it is important to choose a suitable event
in which to set the additional fields because we need to make sure that
the fields are set before the log record is written. Sometimes the right
choice is the same event which writes the log record, but at a higher
priority (in order to ensure that the event handler that sets the additional
fields is executed before the event handler that writes the log record).
In this example, since a connection's summary is generated at
the time its state is removed from memory, we can add another handler
at that time that sets our field correctly:
.. code:: bro
@ -232,31 +193,58 @@ at that time that sets our field correctly:
}
Now ``conn.log`` will show a new field ``is_private`` of type
``bool``.
``bool``. If you look at the Bro script which defines the connection
log stream :doc:`/scripts/base/protocols/conn/main.bro`, you will see
that ``Log::write`` gets called in an event handler for the
same event as used in this example to set the additional fields, but at a
lower priority than the one used in this example (i.e., the log record gets
written after we assign the ``is_private`` field).
Notes:
For extending logs this way, one needs a bit of knowledge about how
the script that creates the log stream is organizing its state
keeping. Most of the standard Bro scripts attach their log state to
the :bro:type:`connection` record where it can then be accessed, just
like ``c$conn`` above. For example, the HTTP analysis adds a field
``http`` of type :bro:type:`HTTP::Info` to the :bro:type:`connection`
record.
- For extending logs this way, one needs a bit of knowledge about how
the script that creates the log stream is organizing its state
keeping. Most of the standard Bro scripts attach their log state to
the :bro:type:`connection` record where it can then be accessed, just
as the ``c$conn`` above. For example, the HTTP analysis adds a field
``http`` of type :bro:type:`HTTP::Info` to the :bro:type:`connection`
record. See the script reference for more information.
- When extending records as shown above, the new fields must always be
declared either with a ``&default`` value or as ``&optional``.
Furthermore, you need to add the ``&log`` attribute or otherwise the
field won't appear in the output.
Hooking into the Logging
------------------------
Define a Logging Event
----------------------
Sometimes it is helpful to do additional analysis of the information
being logged. For these cases, a stream can specify an event that will
be generated every time a log record is written to it. All of Bro's
default log streams define such an event. For example, the connection
log stream raises the event :bro:id:`Conn::log_conn`. You
be generated every time a log record is written to it. To do this, we
need to modify the example module shown above to look something like this:
.. code:: bro
module Foo;
export {
redef enum Log::ID += { LOG };
type Info: record {
ts: time &log;
id: conn_id &log;
service: string &log &optional;
missed_bytes: count &log &default=0;
};
# Define a logging event. By convention, this is called
# "log_<stream>".
global log_foo: event(rec: Info);
}
event bro_init() &priority=5
{
# Specify the "log_foo" event here in order for Bro to raise it.
Log::create_stream(Foo::LOG, [$columns=Info, $ev=log_foo,
$path="foo"]);
}
All of Bro's default log streams define such an event. For example, the
connection log stream raises the event :bro:id:`Conn::log_conn`. You
could use that for example for flagging when a connection to a
specific destination exceeds a certain duration:
@ -270,7 +258,7 @@ specific destination exceeds a certain duration:
event Conn::log_conn(rec: Conn::Info)
{
if ( rec$duration > 5mins )
if ( rec?$duration && rec$duration > 5mins )
NOTICE([$note=Long_Conn_Found,
$msg=fmt("unusually long conn to %s", rec$id$resp_h),
$id=rec$id]);
@ -281,15 +269,196 @@ externally with Perl scripts. Much of what such an external script
would do later offline, one may instead do directly inside of Bro in
real-time.
Rotation
--------
Disable a Stream
----------------
By default, no log rotation occurs, but it's globally controllable for all
filters by redefining the :bro:id:`Log::default_rotation_interval` option:
One way to "turn off" a log is to completely disable the stream. For
example, the following example will prevent the conn.log from being written:
.. code:: bro
redef Log::default_rotation_interval = 1 hr;
event bro_init()
{
Log::disable_stream(Conn::LOG);
}
Note that this must run after the stream is created, so the priority
of this event handler must be lower than the priority of the event handler
where the stream was created.
Filters
=======
A stream has one or more filters attached to it (a stream without any filters
will not produce any log output). When a stream is created, it automatically
gets a default filter attached to it. This default filter can be removed
or replaced, or other filters can be added to the stream. This is accomplished
by using either the :bro:id:`Log::add_filter` or :bro:id:`Log::remove_filter`
function. This section shows how to use filters to do such tasks as
rename a log file, split the output into multiple files, control which
records are written, and set a custom rotation interval.
Rename Log File
---------------
Normally, the log filename for a given log stream is determined when the
stream is created, unless you explicitly specify a different one by adding
a filter.
The easiest way to change a log filename is to simply replace the
default log filter with a new filter that specifies a value for the "path"
field. In this example, "conn.log" will be changed to "myconn.log":
.. code:: bro
event bro_init()
{
# Replace default filter for the Conn::LOG stream in order to
# change the log filename.
local f = Log::get_filter(Conn::LOG, "default");
f$path = "myconn";
Log::add_filter(Conn::LOG, f);
}
Keep in mind that the "path" field of a log filter never contains the
filename extension. The extension will be determined later by the log writer.
Add a New Log File
------------------
Normally, a log stream writes to only one log file. However, you can
add filters so that the stream writes to multiple files. This is useful
if you want to restrict the set of fields being logged to the new file.
In this example, a new filter is added to the Conn::LOG stream that writes
two fields to a new log file:
.. code:: bro
event bro_init()
{
# Add a new filter to the Conn::LOG stream that logs only
# timestamp and originator address.
local filter: Log::Filter = [$name="orig-only", $path="origs",
$include=set("ts", "id.orig_h")];
Log::add_filter(Conn::LOG, filter);
}
Notice how the "include" filter attribute specifies a set that limits the
fields to the ones given. The names correspond to those in the
:bro:type:`Conn::Info` record (however, because the "id" field is itself a
record, we can specify an individual field of "id" by the dot notation
shown in the example).
Using the code above, in addition to the regular ``conn.log``, you will
now also get a new log file ``origs.log`` that looks like the regular
``conn.log``, but will have only the fields specified in the "include"
filter attribute.
If you want to skip only some fields but keep the rest, there is a
corresponding ``exclude`` filter attribute that you can use instead of
``include`` to list only the ones you are not interested in.
If you want to make this the only log file for the stream, you can
remove the default filter:
.. code:: bro
event bro_init()
{
# Remove the filter called "default".
Log::remove_filter(Conn::LOG, "default");
}
Determine Log Path Dynamically
------------------------------
Instead of using the "path" filter attribute, a filter can determine
output paths *dynamically* based on the record being logged. That
allows, e.g., to record local and remote connections into separate
files. To do this, you define a function that returns the desired path,
and use the "path_func" filter attribute:
.. code:: bro
# Note: if using BroControl then you don't need to redef local_nets.
redef Site::local_nets = { 192.168.0.0/16 };
function myfunc(id: Log::ID, path: string, rec: Conn::Info) : string
{
# Return "conn-local" if originator is a local IP, otherwise
# return "conn-remote".
local r = Site::is_local_addr(rec$id$orig_h) ? "local" : "remote";
return fmt("%s-%s", path, r);
}
event bro_init()
{
local filter: Log::Filter = [$name="conn-split",
$path_func=myfunc, $include=set("ts", "id.orig_h")];
Log::add_filter(Conn::LOG, filter);
}
Running this will now produce two new files, ``conn-local.log`` and
``conn-remote.log``, with the corresponding entries (for this example to work,
the ``Site::local_nets`` must specify your local network). One could extend
this further for example to log information by subnets or even by IP
address. Be careful, however, as it is easy to create many files very
quickly.
The ``myfunc`` function has one drawback: it can be used
only with the :bro:enum:`Conn::LOG` stream as the record type is hardcoded
into its argument list. However, Bro allows to do a more generic
variant:
.. code:: bro
function myfunc(id: Log::ID, path: string,
rec: record { id: conn_id; } ) : string
{
local r = Site::is_local_addr(rec$id$orig_h) ? "local" : "remote";
return fmt("%s-%s", path, r);
}
This function can be used with all log streams that have records
containing an ``id: conn_id`` field.
Filter Log Records
------------------
We have seen how to customize the columns being logged, but
you can also control which records are written out by providing a
predicate that will be called for each log record:
.. code:: bro
function http_only(rec: Conn::Info) : bool
{
# Record only connections with successfully analyzed HTTP traffic
return rec?$service && rec$service == "http";
}
event bro_init()
{
local filter: Log::Filter = [$name="http-only", $path="conn-http",
$pred=http_only];
Log::add_filter(Conn::LOG, filter);
}
This will result in a new log file ``conn-http.log`` that contains only
the log records from ``conn.log`` that are analyzed as HTTP traffic.
Rotation
--------
The log rotation interval is globally controllable for all
filters by redefining the :bro:id:`Log::default_rotation_interval` option
(note that when using BroControl, this option is set automatically via
the BroControl configuration).
Or specifically for certain :bro:type:`Log::Filter` instances by setting
their ``interv`` field. Here's an example of changing just the
@ -301,90 +470,73 @@ their ``interv`` field. Here's an example of changing just the
{
local f = Log::get_filter(Conn::LOG, "default");
f$interv = 1 min;
Log::remove_filter(Conn::LOG, "default");
Log::add_filter(Conn::LOG, f);
}
ASCII Writer Configuration
--------------------------
Writers
=======
The ASCII writer has a number of options for customizing the format of
its output, see :doc:`/scripts/base/frameworks/logging/writers/ascii.bro`.
Each filter has a writer. If you do not specify a writer when adding a
filter to a stream, then the ASCII writer is the default.
Adding Streams
==============
There are two ways to specify a non-default writer. To change the default
writer for all log filters, just redefine the :bro:id:`Log::default_writer`
option. Alternatively, you can specify the writer to use on a per-filter
basis by setting a value for the filter's "writer" field. Consult the
documentation of the writer to use to see if there are other options that are
needed.
It's easy to create a new log stream for custom scripts. Here's an
example for the ``Foo`` module:
ASCII Writer
------------
By default, the ASCII writer outputs log files that begin with several
lines of metadata, followed by the actual log output. The metadata
describes the format of the log file, the "path" of the log (i.e., the log
filename without file extension), and also specifies the time that the log
was created and the time when Bro finished writing to it.
The ASCII writer has a number of options for customizing the format of its
output, see :doc:`/scripts/base/frameworks/logging/writers/ascii.bro`.
If you change the output format options, then be careful to check whether
your postprocessing scripts can still recognize your log files.
Some writer options are global (i.e., they affect all log filters using
that log writer). For example, to change the output format of all ASCII
logs to JSON format:
.. code:: bro
module Foo;
redef LogAscii::use_json = T;
export {
# Create an ID for our new stream. By convention, this is
# called "LOG".
redef enum Log::ID += { LOG };
Some writer options are filter-specific (i.e., they affect only the filters
that explicitly specify the option). For example, to change the output
format of the ``conn.log`` only:
# Define the fields. By convention, the type is called "Info".
type Info: record {
ts: time &log;
id: conn_id &log;
};
.. code:: bro
# Define a hook event. By convention, this is called
# "log_<stream>".
global log_foo: event(rec: Info);
}
# This event should be handled at a higher priority so that when
# users modify your stream later and they do it at priority 0,
# their code runs after this.
event bro_init() &priority=5
event bro_init()
{
# Create the stream. This also adds a default filter automatically.
Log::create_stream(Foo::LOG, [$columns=Info, $ev=log_foo, $path="foo"]);
local f = Log::get_filter(Conn::LOG, "default");
# Use tab-separated-value mode
f$config = table(["tsv"] = "T");
Log::add_filter(Conn::LOG, f);
}
You can also add the state to the :bro:type:`connection` record to make
it easily accessible across event handlers:
.. code:: bro
redef record connection += {
foo: Info &optional;
}
Now you can use the :bro:id:`Log::write` method to output log records and
save the logged ``Foo::Info`` record into the connection record:
.. code:: bro
event connection_established(c: connection)
{
local rec: Foo::Info = [$ts=network_time(), $id=c$id];
c$foo = rec;
Log::write(Foo::LOG, rec);
}
See the existing scripts for how to work with such a new connection
field. A simple example is :doc:`/scripts/base/protocols/syslog/main.bro`.
When you are developing scripts that add data to the :bro:type:`connection`
record, care must be given to when and how long data is stored.
Normally data saved to the connection record will remain there for the
duration of the connection and from a practical perspective it's not
uncommon to need to delete that data before the end of the connection.
Other Writers
-------------
Bro supports the following built-in output formats other than ASCII:
Bro supports the following additional built-in output formats:
.. toctree::
:maxdepth: 1
logging-input-sqlite
Further formats are available as external plugins.
Additional writers are available as external plugins:
.. toctree::
:maxdepth: 1
../components/bro-plugins/dataseries/README
../components/bro-plugins/elasticsearch/README

10
doc/install/guidelines.rst
View file

@ -8,10 +8,12 @@ How to Upgrade
If you're doing an upgrade install (rather than a fresh install),
there's two suggested approaches: either install Bro using the same
installation prefix directory as before, or pick a new prefix and copy
local customizations over. Regardless of which approach you choose,
if you are using BroControl, then after upgrading Bro you will need to
run "broctl check" (to verify that your new configuration is OK)
and "broctl install" to complete the upgrade process.
local customizations over.
Regardless of which approach you choose, if you are using BroControl, then
before doing the upgrade you should stop all running Bro processes with the
"broctl stop" command. After the upgrade is complete then you will need
to run "broctl deploy".
In the following we summarize general guidelines for upgrading, see
the :ref:`release-notes` for version-specific information.

22
doc/install/install.rst
View file

@ -46,8 +46,7 @@ To build Bro from source, the following additional dependencies are required:
* zlib headers
* Perl
To install the required dependencies, you can use (when done, make sure
that ``bash`` and ``python`` are in your ``PATH``):
To install the required dependencies, you can use:
* RPM/RedHat-based Linux:
@ -68,13 +67,17 @@ that ``bash`` and ``python`` are in your ``PATH``):
.. console::
sudo pkg_add -r bash cmake swig bison python perl py27-sqlite3
sudo pkg install bash cmake swig bison python perl py27-sqlite3
Note that in older versions of FreeBSD, you might have to use the
"pkg_add -r" command instead of "pkg install".
* Mac OS X:
Compiling source code on Macs requires first downloading Xcode_,
then going through its "Preferences..." -> "Downloads" menus to
install the "Command Line Tools" component.
Compiling source code on Macs requires first installing Xcode_ (in older
versions of Xcode, you would then need to go through its
"Preferences..." -> "Downloads" menus to install the "Command Line Tools"
component).
OS X comes with all required dependencies except for CMake_ and SWIG_.
Distributions of these dependencies can likely be obtained from your
@ -94,7 +97,6 @@ build time:
* curl (used by a Bro script that implements active HTTP)
* gperftools (tcmalloc is used to improve memory and CPU usage)
* ipsumdump (for trace-summary; http://www.cs.ucla.edu/~kohler/ipsumdump)
* Ruby executable, library, and headers (for Broccoli Ruby bindings)
LibGeoIP is probably the most interesting and can be installed
on most platforms by following the instructions for :ref:`installing
@ -119,8 +121,8 @@ platforms for binary releases and for installation instructions.
Linux based binary installations are usually performed by adding
information about the Bro packages to the respective system packaging
tool. Theen the usual system utilities such as ``apt``, ``yum``
or ``zyppper`` are used to perforn the installation. By default,
tool. Then the usual system utilities such as ``apt``, ``yum``
or ``zypper`` are used to perform the installation. By default,
installations of binary packages will go into ``/opt/bro``.
* MacOS Disk Image with Installer
@ -131,7 +133,7 @@ platforms for binary releases and for installation instructions.
The primary install prefix for binary packages is ``/opt/bro``.
Installing from Source
==========================
======================
Bro releases are bundled into source packages for convenience and are
available on the `bro downloads page`_. Alternatively, the latest

7
doc/quickstart/index.rst
View file

@ -24,9 +24,10 @@ Managing Bro with BroControl
BroControl is an interactive shell for easily operating/managing Bro
installations on a single system or even across multiple systems in a
traffic-monitoring cluster. This section explains how to use BroControl
to manage a stand-alone Bro installation. For instructions on how to
configure a Bro cluster, see the :doc:`Cluster Configuration
<../configuration/index>` documentation.
to manage a stand-alone Bro installation. For a complete reference on
BroControl, see the :doc:`BroControl <../components/broctl/README>`
documentation. For instructions on how to configure a Bro cluster,
see the :doc:`Cluster Configuration <../configuration/index>` documentation.
A Minimal Starting Configuration
--------------------------------

9
doc/script-reference/attributes.rst
View file

@ -173,14 +173,20 @@ Here is a more detailed explanation of each attribute:
Rotates a file after a specified interval.
Note: This attribute is deprecated and will be removed in a future release.
.. bro:attr:: &rotate_size
Rotates a file after it has reached a given size in bytes.
Note: This attribute is deprecated and will be removed in a future release.
.. bro:attr:: &encrypt
Encrypts files right before writing them to disk.
Note: This attribute is deprecated and will be removed in a future release.
.. bro:attr:: &raw_output
Opens a file in raw mode, i.e., non-ASCII characters are not
@ -229,5 +235,4 @@ Here is a more detailed explanation of each attribute:
The associated identifier is marked as deprecated and will be
removed in a future version of Bro. Look in the NEWS file for more
explanation and/or instructions to migrate code that uses deprecated
functionality.
instructions to migrate code that uses deprecated functionality.

17
doc/script-reference/directives.rst
View file

@ -58,6 +58,23 @@ executed. Directives are evaluated before script execution begins.
for that script are ignored).
.. bro:keyword:: @load-plugin
Activate a dynamic plugin with the specified plugin name. The specified
plugin must be located in Bro's plugin search path. Example::
@load-plugin Demo::Rot13
By default, Bro will automatically activate all dynamic plugins found
in the plugin search path (the search path can be changed by setting
the environment variable BRO_PLUGIN_PATH to a colon-separated list of
directories). However, in bare mode ("bro -b"), dynamic plugins can be
activated only by using "@load-plugin", or by specifying the full
plugin name on the Bro command-line (e.g., "bro Demo::Rot13"), or by
setting the environment variable BRO_PLUGIN_ACTIVATE to a
comma-separated list of plugin names.
.. bro:keyword:: @load-sigs
This works similarly to "@load", except that in this case the filename

10
doc/script-reference/log-files.rst
View file

@ -26,13 +26,21 @@ Network Protocols
+----------------------------+---------------------------------------+---------------------------------+
| irc.log | IRC commands and responses | :bro:type:`IRC::Info` |
+----------------------------+---------------------------------------+---------------------------------+
| kerberos.log | Kerberos | :bro:type:`KRB::Info` |
+----------------------------+---------------------------------------+---------------------------------+
| modbus.log | Modbus commands and responses | :bro:type:`Modbus::Info` |
+----------------------------+---------------------------------------+---------------------------------+
| modbus_register_change.log | Tracks changes to Modbus holding | :bro:type:`Modbus::MemmapInfo` |
| | registers | |
+----------------------------+---------------------------------------+---------------------------------+
| mysql.log | MySQL | :bro:type:`MySQL::Info` |
+----------------------------+---------------------------------------+---------------------------------+
| radius.log | RADIUS authentication attempts | :bro:type:`RADIUS::Info` |
+----------------------------+---------------------------------------+---------------------------------+
| rdp.log | RDP | :bro:type:`RDP::Info` |
+----------------------------+---------------------------------------+---------------------------------+
| sip.log | SIP | :bro:type:`SIP::Info` |
+----------------------------+---------------------------------------+---------------------------------+
| smtp.log | SMTP transactions | :bro:type:`SMTP::Info` |
+----------------------------+---------------------------------------+---------------------------------+
| snmp.log | SNMP messages | :bro:type:`SNMP::Info` |
@ -56,6 +64,8 @@ Files
+============================+=======================================+=================================+
| files.log | File analysis results | :bro:type:`Files::Info` |
+----------------------------+---------------------------------------+---------------------------------+
| pe.log | Portable Executable (PE) | :bro:type:`PE::Info` |
+----------------------------+---------------------------------------+---------------------------------+
| x509.log | X.509 certificate info | :bro:type:`X509::Info` |
+----------------------------+---------------------------------------+---------------------------------+

16
doc/script-reference/statements.rst
View file

@ -258,8 +258,8 @@ Here are the statements that the Bro scripting language supports.
.. bro:keyword:: break
The "break" statement is used to break out of a :bro:keyword:`switch` or
:bro:keyword:`for` statement.
The "break" statement is used to break out of a :bro:keyword:`switch`,
:bro:keyword:`for`, or :bro:keyword:`while` statement.
.. bro:keyword:: delete
@ -379,10 +379,10 @@ Here are the statements that the Bro scripting language supports.
.. bro:keyword:: next
The "next" statement can only appear within a :bro:keyword:`for` loop.
It causes execution to skip to the next iteration.
The "next" statement can only appear within a :bro:keyword:`for` or
:bro:keyword:`while` loop. It causes execution to skip to the next
iteration.
For an example, see the :bro:keyword:`for` statement.
.. bro:keyword:: print
@ -571,7 +571,7 @@ Here are the statements that the Bro scripting language supports.
.. bro:keyword:: while
A "while" loop iterates over a body statement as long a given
A "while" loop iterates over a body statement as long as a given
condition remains true.
A :bro:keyword:`break` statement can be used at any time to immediately
@ -609,8 +609,8 @@ Here are the statements that the Bro scripting language supports.
(outside of the braces) of a compound statement.
A compound statement is required in order to execute more than one
statement in the body of a :bro:keyword:`for`, :bro:keyword:`if`, or
:bro:keyword:`when` statement.
statement in the body of a :bro:keyword:`for`, :bro:keyword:`while`,
:bro:keyword:`if`, or :bro:keyword:`when` statement.
Example::

33
man/bro.8
View file

@ -51,12 +51,6 @@ add given prefix to policy file resolution
\fB\-r\fR,\ \-\-readfile <readfile>
read from given tcpdump file
.TP
\fB\-y\fR,\ \-\-flowfile <file>[=<ident>]
read from given flow file
.TP
\fB\-Y\fR,\ \-\-netflow <ip>:<prt>[=<id>]
read flow from socket
.TP
\fB\-s\fR,\ \-\-rulefile <rulefile>
read rules from given file
.TP
@ -78,27 +72,21 @@ run the specified policy file analysis
\fB\-C\fR,\ \-\-no\-checksums
ignore checksums
.TP
\fB\-D\fR,\ \-\-dfa\-size <size>
DFA state cache size
.TP
\fB\-F\fR,\ \-\-force\-dns
force DNS
.TP
\fB\-I\fR,\ \-\-print\-id <ID name>
print out given ID
.TP
\fB\-J\fR,\ \-\-set\-seed <seed>
set the random number seed
.TP
\fB\-K\fR,\ \-\-md5\-hashkey <hashkey>
set key for MD5\-keyed hashing
.TP
\fB\-L\fR,\ \-\-rule\-benchmark
benchmark for rules
.TP
\fB\-N\fR,\ \-\-print\-plugins
print available plugins and exit (\fB\-NN\fR for verbose)
.TP
\fB\-O\fR,\ \-\-optimize
optimize policy script
.TP
\fB\-P\fR,\ \-\-prime\-dns
prime DNS
.TP
@ -120,7 +108,7 @@ Record process status in file
\fB\-W\fR,\ \-\-watchdog
activate watchdog timer
.TP
\fB\-X\fR,\ \-\-broxygen
\fB\-X\fR,\ \-\-broxygen <cfgfile>
generate documentation based on config file
.TP
\fB\-\-pseudo\-realtime[=\fR<speedup>]
@ -131,6 +119,19 @@ load seeds from given file
.TP
\fB\-\-save\-seeds\fR <file>
save seeds to given file
.TP
The following option is available only when Bro is built with the \-\-enable\-debug configure option:
.TP
\fB\-B\fR,\ \-\-debug <dbgstreams>
Enable debugging output for selected streams ('-B help' for help)
.TP
The following options are available only when Bro is built with gperftools support (use the \-\-enable\-perftools and \-\-enable\-perftools\-debug configure options):
.TP
\fB\-m\fR,\ \-\-mem-leaks
show leaks
.TP
\fB\-M\fR,\ \-\-mem-profile
record heap
.SH ENVIRONMENT
.TP
.B BROPATH

1
scripts/base/files/pe/README Normal file
View file

@ -0,0 +1 @@
Support for Portable Executable (PE) file analysis.

2
scripts/base/frameworks/broker/README Normal file
View file

@ -0,0 +1,2 @@
The Broker communication framework facilitates connecting to remote Bro
instances to share state and transfer events.

6
scripts/base/frameworks/files/magic/general.sig
View file

@ -78,6 +78,12 @@ signature file-coldfusion {
file-magic /^([\x0d\x0a[:blank:]]*(<!--.*-->)?)*<(CFPARAM|CFSET|CFIF)/
}
# Adobe Flash Media Manifest
signature file-f4m {
file-mime "application/f4m", 49
file-magic /^(\xef\xbb\xbf)?([\x0d\x0a[:blank:]]*(<!--.*-->)?[\x0d\x0a[:blank:]]*)*(<\?xml .*\?>)?([\x0d\x0a[:blank:]]*(<!--.*-->)?[\x0d\x0a[:blank:]]*)*<[mM][aA][nN][iI][fF][eE][sS][tT][\x0d\x0a[:blank:]]{1,}xmlns=\"http:\/\/ns\.adobe\.com\/f4m\//
}
# Microsoft LNK files
signature file-lnk {
file-mime "application/x-ms-shortcut", 49

53
scripts/base/frameworks/logging/main.bro
View file

@ -6,9 +6,10 @@
module Log;
export {
## Type that defines an ID unique to each log stream. Scripts creating new log
## streams need to redef this enum to add their own specific log ID. The log ID
## implicitly determines the default name of the generated log file.
## Type that defines an ID unique to each log stream. Scripts creating new
## log streams need to redef this enum to add their own specific log ID.
## The log ID implicitly determines the default name of the generated log
## file.
type Log::ID: enum {
## Dummy place-holder.
UNKNOWN
@ -20,25 +21,24 @@ export {
## If true, remote logging is by default enabled for all filters.
const enable_remote_logging = T &redef;
## Default writer to use if a filter does not specify
## anything else.
## Default writer to use if a filter does not specify anything else.
const default_writer = WRITER_ASCII &redef;
## Default separator between fields for logwriters.
## Can be overwritten by individual writers.
## Default separator to use between fields.
## Individual writers can use a different value.
const separator = "\t" &redef;
## Separator between set elements.
## Can be overwritten by individual writers.
## Default separator to use between elements of a set.
## Individual writers can use a different value.
const set_separator = "," &redef;
## String to use for empty fields. This should be different from
## *unset_field* to make the output unambiguous.
## Can be overwritten by individual writers.
## Default string to use for empty fields. This should be different
## from *unset_field* to make the output unambiguous.
## Individual writers can use a different value.
const empty_field = "(empty)" &redef;
## String to use for an unset &optional field.
## Can be overwritten by individual writers.
## Default string to use for an unset &optional field.
## Individual writers can use a different value.
const unset_field = "-" &redef;
## Type defining the content of a logging stream.
@ -69,7 +69,7 @@ export {
## If no ``path`` is defined for the filter, then the first call
## to the function will contain an empty string.
##
## rec: An instance of the streams's ``columns`` type with its
## rec: An instance of the stream's ``columns`` type with its
## fields set to the values to be logged.
##
## Returns: The path to be used for the filter.
@ -87,7 +87,8 @@ export {
terminating: bool; ##< True if rotation occured due to Bro shutting down.
};
## Default rotation interval. Zero disables rotation.
## Default rotation interval to use for filters that do not specify
## an interval. Zero disables rotation.
##
## Note that this is overridden by the BroControl LogRotationInterval
## option.
@ -122,8 +123,8 @@ export {
## Indicates whether a log entry should be recorded.
## If not given, all entries are recorded.
##
## rec: An instance of the streams's ``columns`` type with its
## fields set to the values to logged.
## rec: An instance of the stream's ``columns`` type with its
## fields set to the values to be logged.
##
## Returns: True if the entry is to be recorded.
pred: function(rec: any): bool &optional;
@ -131,10 +132,10 @@ export {
## Output path for recording entries matching this
## filter.
##
## The specific interpretation of the string is up to
## the used writer, and may for example be the destination
## The specific interpretation of the string is up to the
## logging writer, and may for example be the destination
## file name. Generally, filenames are expected to be given
## without any extensions; writers will add appropiate
## without any extensions; writers will add appropriate
## extensions automatically.
##
## If this path is found to conflict with another filter's
@ -151,7 +152,7 @@ export {
## easy to flood the disk by returning a new string for each
## connection. Upon adding a filter to a stream, if neither
## ``path`` nor ``path_func`` is explicitly set by them, then
## :bro:see:`default_path_func` is used.
## :bro:see:`Log::default_path_func` is used.
##
## id: The ID associated with the log stream.
##
@ -161,7 +162,7 @@ export {
## then the first call to the function will contain an
## empty string.
##
## rec: An instance of the streams's ``columns`` type with its
## rec: An instance of the stream's ``columns`` type with its
## fields set to the values to be logged.
##
## Returns: The path to be used for the filter, which will be
@ -185,7 +186,7 @@ export {
## If true, entries are passed on to remote peers.
log_remote: bool &default=enable_remote_logging;
## Rotation interval.
## Rotation interval. Zero disables rotation.
interv: interval &default=default_rotation_interval;
## Callback function to trigger for rotated files. If not set, the
@ -215,9 +216,9 @@ export {
## Removes a logging stream completely, stopping all the threads.
##
## id: The ID enum to be associated with the new logging stream.
## id: The ID associated with the logging stream.
##
## Returns: True if a new stream was successfully removed.
## Returns: True if the stream was successfully removed.
##
## .. bro:see:: Log::create_stream
global remove_stream: function(id: ID) : bool;

14
scripts/base/frameworks/logging/writers/ascii.bro
View file

@ -1,15 +1,15 @@
##! Interface for the ASCII log writer. Redefinable options are available
##! to tweak the output format of ASCII logs.
##!
##! The ASCII writer supports currently one writer-specific filter option via
##! ``config``: setting ``tsv`` to the string ``T`` turns the output into
##! The ASCII writer currently supports one writer-specific per-filter config
##! option: setting ``tsv`` to the string ``T`` turns the output into
##! "tab-separated-value" mode where only a single header row with the column
##! names is printed out as meta information, with no "# fields" prepended; no
##! other meta data gets included in that mode.
##! other meta data gets included in that mode. Example filter using this::
##!
##! Example filter using this::
##!
##! local my_filter: Log::Filter = [$name = "my-filter", $writer = Log::WRITER_ASCII, $config = table(["tsv"] = "T")];
##! local f: Log::Filter = [$name = "my-filter",
##! $writer = Log::WRITER_ASCII,
##! $config = table(["tsv"] = "T")];
##!
module LogAscii;
@ -29,6 +29,8 @@ export {
## Format of timestamps when writing out JSON. By default, the JSON
## formatter will use double values for timestamps which represent the
## number of seconds from the UNIX epoch.
##
## This option is also available as a per-filter ``$config`` option.
const json_timestamps: JSON::TimestampFormat = JSON::TS_EPOCH &redef;
## If true, include lines with log meta information such as column names

2
scripts/base/frameworks/logging/writers/sqlite.bro
View file

@ -19,7 +19,7 @@ export {
const unset_field = Log::unset_field &redef;
## String to use for empty fields. This should be different from
## *unset_field* to make the output unambiguous.
## *unset_field* to make the output unambiguous.
const empty_field = Log::empty_field &redef;
}

5
scripts/base/init-bare.bro
View file

@ -966,6 +966,11 @@ const tcp_max_above_hole_without_any_acks = 16384 &redef;
## .. bro:see:: tcp_max_initial_window tcp_max_above_hole_without_any_acks
const tcp_excessive_data_without_further_acks = 10 * 1024 * 1024 &redef;
## Number of TCP segments to buffer beyond what's been acknowledged already
## to detect retransmission inconsistencies. Zero disables any additonal
## buffering.
const tcp_max_old_segments = 0 &redef;
## For services without a handler, these sets define originator-side ports
## that still trigger reassembly.
##

2
scripts/base/protocols/ftp/gridftp.bro
View file

@ -86,7 +86,7 @@ event gridftp_possibility_timeout(c: connection)
{
# only remove if we did not already detect it and the connection
# is not yet at its end.
if ( "gridftp-data" !in c$service && ! c$conn?$service )
if ( "gridftp-data" !in c$service && ! (c?$conn && c$conn?$service) )
{
ConnThreshold::delete_bytes_threshold(c, size_threshold, T);
ConnThreshold::delete_bytes_threshold(c, size_threshold, F);

1
scripts/base/protocols/krb/README Normal file
View file

@ -0,0 +1 @@
Support for Kerberos protocol analysis.

3
scripts/base/protocols/krb/main.bro
View file

@ -1,4 +1,5 @@
##! Implements base functionality for KRB analysis. Generates the krb.log file.
##! Implements base functionality for KRB analysis. Generates the kerberos.log
##! file.
module KRB;

1
scripts/base/protocols/mysql/README Normal file
View file

@ -0,0 +1 @@
Support for MySQL protocol analysis.

1
scripts/base/protocols/radius/README Normal file
View file

@ -0,0 +1 @@
Support for RADIUS protocol analysis.

1
scripts/base/protocols/rdp/README Normal file
View file

@ -0,0 +1 @@
Support for Remote Desktop Protocol (RDP) analysis.

1
scripts/base/protocols/sip/README Normal file
View file

@ -0,0 +1 @@
Support for Session Initiation Protocol (SIP) analysis.

1
scripts/base/protocols/ssh/README Normal file
View file

@ -0,0 +1 @@
Support for SSH protocol analysis.

4
scripts/base/protocols/ssl/mozilla-ca-list.bro
View file

File diff suppressed because one or more lines are too long

34
scripts/base/utils/urls.bro
View file

@ -6,23 +6,23 @@ const url_regex = /^([a-zA-Z\-]{3,5})(:\/\/[^\/?#"'\r\n><]*)([^?#"'\r\n><]*)([^[
## A URI, as parsed by :bro:id:`decompose_uri`.
type URI: record {
## The URL's scheme..
scheme: string &optional;
scheme: string &optional;
## The location, which could be a domain name or an IP address. Left empty if not
## specified.
netlocation: string;
netlocation: string;
## Port number, if included in URI.
portnum: count &optional;
portnum: count &optional;
## Full including the file name. Will be '/' if there's not path given.
path: string;
path: string;
## Full file name, including extension, if there is a file name.
file_name: string &optional;
file_name: string &optional;
## The base filename, without extension, if there is a file name.
file_base: string &optional;
file_base: string &optional;
## The filename's extension, if there is a file name.
file_ext: string &optional;
file_ext: string &optional;
## A table of all query parameters, mapping their keys to values, if there's a
## query.
params: table[string] of string &optional;
params: table[string] of string &optional;
};
## Extracts URLs discovered in arbitrary text.
@ -46,19 +46,19 @@ function find_all_urls_without_scheme(s: string): string_set
return return_urls;
}
function decompose_uri(s: string): URI
function decompose_uri(uri: string): URI
{
local parts: string_vec;
local u: URI = [$netlocation="", $path="/"];
local u = URI($netlocation="", $path="/");
local s = uri;
if ( /\?/ in s)
if ( /\?/ in s )
{
# Parse query.
u$params = table();
parts = split_string1(s, /\?/);
s = parts[0];
local query: string = parts[1];
local query = parts[1];
if ( /&/ in query )
{
@ -73,7 +73,7 @@ function decompose_uri(s: string): URI
}
}
}
else
else if ( /=/ in query )
{
parts = split_string1(query, /=/);
u$params[parts[0]] = parts[1];
@ -97,14 +97,14 @@ function decompose_uri(s: string): URI
if ( |u$path| > 1 && u$path[|u$path| - 1] != "/" )
{
local last_token: string = find_last(u$path, /\/.+/);
local last_token = find_last(u$path, /\/.+/);
local full_filename = split_string1(last_token, /\//)[1];
if ( /\./ in full_filename )
{
u$file_name = full_filename;
u$file_base = split_string1(full_filename, /\./)[0];
u$file_ext = split_string1(full_filename, /\./)[1];
u$file_ext = split_string1(full_filename, /\./)[1];
}
else
{
@ -122,7 +122,9 @@ function decompose_uri(s: string): URI
u$portnum = to_count(parts[1]);
}
else
{
u$netlocation = s;
}
return u;
}

9
src/DNS_Mgr.cc
View file

@ -1219,6 +1219,9 @@ void DNS_Mgr::IssueAsyncRequests()
void DNS_Mgr::GetFds(iosource::FD_Set* read, iosource::FD_Set* write,
iosource::FD_Set* except)
{
if ( ! nb_dns )
return;
read->Insert(nb_dns_fd(nb_dns));
}
@ -1358,6 +1361,9 @@ void DNS_Mgr::Process()
void DNS_Mgr::DoProcess(bool flush)
{
if ( ! nb_dns )
return;
while ( asyncs_timeouts.size() > 0 )
{
AsyncRequest* req = asyncs_timeouts.top();
@ -1422,6 +1428,9 @@ void DNS_Mgr::DoProcess(bool flush)
int DNS_Mgr::AnswerAvailable(int timeout)
{
if ( ! nb_dns )
return -1;
int fd = nb_dns_fd(nb_dns);
if ( fd < 0 )
{

2
src/NetVar.cc
View file

@ -49,6 +49,7 @@ double tcp_partial_close_delay;
int tcp_max_initial_window;
int tcp_max_above_hole_without_any_acks;
int tcp_excessive_data_without_further_acks;
int tcp_max_old_segments;
RecordType* socks_address;
@ -354,6 +355,7 @@ void init_net_var()
opt_internal_int("tcp_max_above_hole_without_any_acks");
tcp_excessive_data_without_further_acks =
opt_internal_int("tcp_excessive_data_without_further_acks");
tcp_max_old_segments = opt_internal_int("tcp_max_old_segments");
socks_address = internal_type("SOCKS::Address")->AsRecordType();

1
src/NetVar.h
View file

@ -52,6 +52,7 @@ extern double tcp_reset_delay;
extern int tcp_max_initial_window;
extern int tcp_max_above_hole_without_any_acks;
extern int tcp_excessive_data_without_further_acks;
extern int tcp_max_old_segments;
extern RecordType* socks_address;

91
src/Reassem.cc
View file

@ -34,12 +34,52 @@ uint64 Reassembler::total_size = 0;
Reassembler::Reassembler(uint64 init_seq)
{
blocks = last_block = 0;
old_blocks = last_old_block = 0;
total_old_blocks = max_old_blocks = 0;
trim_seq = last_reassem_seq = init_seq;
}
Reassembler::~Reassembler()
{
ClearBlocks();
ClearOldBlocks();
}
void Reassembler::CheckOverlap(DataBlock *head, DataBlock *tail,
uint64 seq, uint64 len, const u_char* data)
{
if ( ! head || ! tail )
return;
uint64 upper = (seq + len);
for ( DataBlock* b = head; b; b = b->next )
{
uint64 nseq = seq;
uint64 nupper = upper;
const u_char* ndata = data;
if ( nupper <= b->seq )
continue;
if ( nseq >= b->upper )
continue;
if ( nseq < b->seq )
{
ndata += (b->seq - seq);
nseq = b->seq;
}
if ( nupper > b->upper )
nupper = b->upper;
uint64 overlap_offset = (nseq - b->seq);
uint64 overlap_len = (nupper - nseq);
if ( overlap_len )
Overlap(&b->block[overlap_offset], ndata, overlap_len);
}
}
void Reassembler::NewBlock(double t, uint64 seq, uint64 len, const u_char* data)
@ -49,10 +89,14 @@ void Reassembler::NewBlock(double t, uint64 seq, uint64 len, const u_char* data)
uint64 upper_seq = seq + len;
CheckOverlap(old_blocks, last_old_block, seq, len, data);
if ( upper_seq <= trim_seq )
// Old data, don't do any work for it.
return;
CheckOverlap(blocks, last_block, seq, len, data);
if ( seq < trim_seq )
{ // Partially old data, just keep the good stuff.
uint64 amount_old = trim_seq - seq;
@ -119,7 +163,36 @@ uint64 Reassembler::TrimToSeq(uint64 seq)
num_missing += seq - blocks->upper;
}
delete blocks;
if ( max_old_blocks )
{
// Move block over to old_blocks queue.
blocks->next = 0;
if ( last_old_block )
{
blocks->prev = last_old_block;
last_old_block->next = blocks;
}
else
{
blocks->prev = 0;
old_blocks = blocks;
}
last_old_block = blocks;
total_old_blocks++;
while ( old_blocks && total_old_blocks > max_old_blocks )
{
DataBlock* next = old_blocks->next;
delete old_blocks;
old_blocks = next;
total_old_blocks--;
}
}
else
delete blocks;
blocks = b;
}
@ -156,6 +229,18 @@ void Reassembler::ClearBlocks()
last_block = 0;
}
void Reassembler::ClearOldBlocks()
{
while ( old_blocks )
{
DataBlock* b = old_blocks->next;
delete old_blocks;
old_blocks = b;
}
last_old_block = 0;
}
uint64 Reassembler::TotalSize() const
{
uint64 size = 0;
@ -218,7 +303,7 @@ DataBlock* Reassembler::AddAndCheck(DataBlock* b, uint64 seq, uint64 upper,
return new_b;
}
// The blocks overlap, complain.
// The blocks overlap.
if ( seq < b->seq )
{
// The new block has a prefix that comes before b.
@ -239,8 +324,6 @@ DataBlock* Reassembler::AddAndCheck(DataBlock* b, uint64 seq, uint64 upper,
uint64 b_len = b->upper - overlap_start;
uint64 overlap_len = min(new_b_len, b_len);
Overlap(&b->block[overlap_offset], data, overlap_len);
if ( overlap_len < new_b_len )
{
// Recurse to resolve remainder of the new data.

12
src/Reassem.h
View file

@ -36,6 +36,7 @@ public:
// Delete all held blocks.
void ClearBlocks();
void ClearOldBlocks();
int HasBlocks() const { return blocks != 0; }
uint64 LastReassemSeq() const { return last_reassem_seq; }
@ -50,6 +51,8 @@ public:
// Sum over all data buffered in some reassembler.
static uint64 TotalMemoryAllocation() { return total_size; }
void SetMaxOldBlocks(uint32 count) { max_old_blocks = count; }
protected:
Reassembler() { }
@ -65,10 +68,19 @@ protected:
DataBlock* AddAndCheck(DataBlock* b, uint64 seq,
uint64 upper, const u_char* data);
void CheckOverlap(DataBlock *head, DataBlock *tail,
uint64 seq, uint64 len, const u_char* data);
DataBlock* blocks;
DataBlock* last_block;
DataBlock* old_blocks;
DataBlock* last_old_block;
uint64 last_reassem_seq;
uint64 trim_seq; // how far we've trimmed
uint32 max_old_blocks;
uint32 total_old_blocks;
static uint64 total_size;
};

7
src/analyzer/protocol/http/HTTP.cc
View file

@ -1025,8 +1025,11 @@ void HTTP_Analyzer::DeliverStream(int len, const u_char* data, bool is_orig)
}
else
{
ProtocolViolation("not a http reply line");
reply_state = EXPECT_REPLY_NOTHING;
if ( line != end_of_line )
{
ProtocolViolation("not a http reply line");
reply_state = EXPECT_REPLY_NOTHING;
}
}
break;

76
src/analyzer/protocol/mime/MIME.cc
View file

@ -141,10 +141,9 @@ int fputs(data_chunk_t b, FILE* fp)
void MIME_Mail::Undelivered(int len)
{
// is_orig param not available, doesn't matter as long as it's consistent
cur_entity_id = file_mgr->Gap(cur_entity_len, len,
analyzer->GetAnalyzerTag(), analyzer->Conn(),
false, cur_entity_id);
is_orig, cur_entity_id);
}
int strcasecmp_n(data_chunk_t s, const char* t)
@ -246,11 +245,16 @@ int MIME_get_field_name(int len, const char* data, data_chunk_t* name)
}
// See RFC 2045, page 12.
int MIME_is_tspecial (char ch)
int MIME_is_tspecial (char ch, bool is_boundary = false)
{
return ch == '(' || ch == ')' || ch == '<' || ch == '>' || ch == '@' ||
ch == ',' || ch == ';' || ch == ':' || ch == '\\' || ch == '"' ||
ch == '/' || ch == '[' || ch == ']' || ch == '?' || ch == '=';
if ( is_boundary )
return ch == '(' || ch == ')' || ch == '@' ||
ch == ',' || ch == ';' || ch == ':' || ch == '\\' || ch == '"' ||
ch == '/' || ch == '[' || ch == ']' || ch == '?' || ch == '=';
else
return ch == '(' || ch == ')' || ch == '<' || ch == '>' || ch == '@' ||
ch == ',' || ch == ';' || ch == ':' || ch == '\\' || ch == '"' ||
ch == '/' || ch == '[' || ch == ']' || ch == '?' || ch == '=';
}
int MIME_is_field_name_char (char ch)
@ -258,26 +262,27 @@ int MIME_is_field_name_char (char ch)
return ch >= 33 && ch <= 126 && ch != ':';
}
int MIME_is_token_char (char ch)
int MIME_is_token_char (char ch, bool is_boundary = false)
{
return ch >= 33 && ch <= 126 && ! MIME_is_tspecial(ch);
return ch >= 33 && ch <= 126 && ! MIME_is_tspecial(ch, is_boundary);
}
// See RFC 2045, page 12.
// A token is composed of characters that are not SPACE, CTLs or tspecials
int MIME_get_token(int len, const char* data, data_chunk_t* token)
int MIME_get_token(int len, const char* data, data_chunk_t* token,
bool is_boundary)
{
int i = MIME_skip_lws_comments(len, data);
while ( i < len )
{
int j;
if ( MIME_is_token_char(data[i]) )
if ( MIME_is_token_char(data[i], is_boundary) )
{
token->data = (data + i);
for ( j = i; j < len; ++j )
{
if ( ! MIME_is_token_char(data[j]) )
if ( ! MIME_is_token_char(data[j], is_boundary) )
break;
}
@ -359,7 +364,7 @@ int MIME_get_quoted_string(int len, const char* data, data_chunk_t* str)
return -1;
}
int MIME_get_value(int len, const char* data, BroString*& buf)
int MIME_get_value(int len, const char* data, BroString*& buf, bool is_boundary)
{
int offset = MIME_skip_lws_comments(len, data);
@ -380,7 +385,7 @@ int MIME_get_value(int len, const char* data, BroString*& buf)
else
{
data_chunk_t str;
int end = MIME_get_token(len, data, &str);
int end = MIME_get_token(len, data, &str, is_boundary);
if ( end < 0 )
return -1;
@ -863,8 +868,22 @@ int MIME_Entity::ParseFieldParameters(int len, const char* data)
len -= offset;
BroString* val = 0;
// token or quoted-string
offset = MIME_get_value(len, data, val);
if ( current_field_type == MIME_CONTENT_TYPE &&
content_type == CONTENT_TYPE_MULTIPART &&
strcasecmp_n(attr, "boundary") == 0 )
{
// token or quoted-string (and some lenience for characters
// not explicitly allowed by the RFC, but encountered in the wild)
offset = MIME_get_value(len, data, val, true);
data_chunk_t vd = get_data_chunk(val);
multipart_boundary = new BroString((const u_char*)vd.data,
vd.length, 1);
}
else
// token or quoted-string
offset = MIME_get_value(len, data, val);
if ( offset < 0 )
{
IllegalFormat("value not found in parameter specification");
@ -874,8 +893,6 @@ int MIME_Entity::ParseFieldParameters(int len, const char* data)
data += offset;
len -= offset;
ParseParameter(attr, get_data_chunk(val));
delete val;
}
@ -920,24 +937,6 @@ void MIME_Entity::ParseContentEncoding(data_chunk_t encoding_mechanism)
content_encoding = i;
}
void MIME_Entity::ParseParameter(data_chunk_t attr, data_chunk_t val)
{
switch ( current_field_type ) {
case MIME_CONTENT_TYPE:
if ( content_type == CONTENT_TYPE_MULTIPART &&
strcasecmp_n(attr, "boundary") == 0 )
multipart_boundary = new BroString((const u_char*)val.data, val.length, 1);
break;
case MIME_CONTENT_TRANSFER_ENCODING:
break;
default:
break;
}
}
int MIME_Entity::CheckBoundaryDelimiter(int len, const char* data)
{
if ( ! multipart_boundary )
@ -1286,13 +1285,15 @@ TableVal* MIME_Message::BuildHeaderTable(MIME_HeaderList& hlist)
return t;
}
MIME_Mail::MIME_Mail(analyzer::Analyzer* mail_analyzer, int buf_size)
MIME_Mail::MIME_Mail(analyzer::Analyzer* mail_analyzer, bool orig, int buf_size)
: MIME_Message(mail_analyzer), md5_hash()
{
analyzer = mail_analyzer;
min_overlap_length = mime_segment_overlap_length;
max_chunk_length = mime_segment_length;
is_orig = orig;
int length = buf_size;
if ( min_overlap_length < 0 )
@ -1456,9 +1457,8 @@ void MIME_Mail::SubmitData(int len, const char* buf)
analyzer->ConnectionEvent(mime_segment_data, vl);
}
// is_orig param not available, doesn't matter as long as it's consistent
cur_entity_id = file_mgr->DataIn(reinterpret_cast<const u_char*>(buf), len,
analyzer->GetAnalyzerTag(), analyzer->Conn(), false,
analyzer->GetAnalyzerTag(), analyzer->Conn(), is_orig,
cur_entity_id);
cur_entity_len += len;

10
src/analyzer/protocol/mime/MIME.h
View file

@ -117,7 +117,6 @@ protected:
void ParseContentType(data_chunk_t type, data_chunk_t sub_type);
void ParseContentEncoding(data_chunk_t encoding_mechanism);
void ParseParameter(data_chunk_t attr, data_chunk_t val);
void BeginBody();
void NewDataLine(int len, const char* data, int trailing_CRLF);
@ -231,7 +230,7 @@ protected:
class MIME_Mail : public MIME_Message {
public:
MIME_Mail(analyzer::Analyzer* mail_conn, int buf_size = 0);
MIME_Mail(analyzer::Analyzer* mail_conn, bool is_orig, int buf_size = 0);
~MIME_Mail();
void Done();
@ -248,6 +247,7 @@ public:
protected:
int min_overlap_length;
int max_chunk_length;
bool is_orig;
int buffer_start;
int data_start;
int compute_content_hash;
@ -275,9 +275,11 @@ extern int MIME_count_leading_lws(int len, const char* data);
extern int MIME_count_trailing_lws(int len, const char* data);
extern int MIME_skip_comments(int len, const char* data);
extern int MIME_skip_lws_comments(int len, const char* data);
extern int MIME_get_token(int len, const char* data, data_chunk_t* token);
extern int MIME_get_token(int len, const char* data, data_chunk_t* token,
bool is_boundary = false);
extern int MIME_get_slash_token_pair(int len, const char* data, data_chunk_t* first, data_chunk_t* second);
extern int MIME_get_value(int len, const char* data, BroString*& buf);
extern int MIME_get_value(int len, const char* data, BroString*& buf,
bool is_boundary = false);
extern int MIME_get_field_name(int len, const char* data, data_chunk_t* name);
extern BroString* MIME_decode_quoted_pairs(data_chunk_t buf);

51
src/analyzer/protocol/modbus/modbus-analyzer.pac
View file

@ -47,6 +47,42 @@
%}
refine connection ModbusTCP_Conn += {
%member{
// Fields used to determine if the protocol has been confirmed or not.
bool confirmed;
bool orig_pdu;
bool resp_pdu;
%}
%init{
confirmed = false;
orig_pdu = false;
resp_pdu = false;
%}
function SetPDU(is_orig: bool): bool
%{
if ( is_orig )
orig_pdu = true;
else
resp_pdu = true;
return true;
%}
function SetConfirmed(): bool
%{
confirmed = true;
return true;
%}
function IsConfirmed(): bool
%{
return confirmed && orig_pdu && resp_pdu;
%}
};
refine flow ModbusTCP_Flow += {
function deliver_message(header: ModbusTCP_TransportHeader): bool
@ -62,6 +98,21 @@ refine flow ModbusTCP_Flow += {
return true;
%}
function deliver_ModbusTCP_PDU(message: ModbusTCP_PDU): bool
%{
// We will assume that if an entire PDU from both sides
// is successfully parsed then this is definitely modbus.
connection()->SetPDU(${message.is_orig});
if ( ! connection()->IsConfirmed() )
{
connection()->SetConfirmed();
connection()->bro_analyzer()->ProtocolConfirmation();
}
return true;
%}
# EXCEPTION
function deliver_Exception(header: ModbusTCP_TransportHeader, message: Exception): bool
%{

2
src/analyzer/protocol/modbus/modbus-protocol.pac
View file

@ -64,6 +64,8 @@ type ModbusTCP_PDU(is_orig: bool) = record {
true -> request: ModbusTCP_Request(header);
false -> response: ModbusTCP_Response(header);
};
} &let {
deliver: bool = $context.flow.deliver_ModbusTCP_PDU(this);
} &length=header.len+6, &byteorder=bigendian;
type ModbusTCP_TransportHeader = record {

7
src/analyzer/protocol/pop3/POP3.cc
View file

@ -712,7 +712,8 @@ void POP3_Analyzer::ProcessReply(int length, const char* line)
{
int data_len = end_of_line - line;
if ( ! mail )
BeginData();
// ProcessReply is only called if orig == false
BeginData(false);
ProcessData(data_len, line);
if ( requestForMultiLine == true )
multiLine = true;
@ -838,10 +839,10 @@ void POP3_Analyzer::AuthSuccessfull()
user.c_str(), password.c_str());
}
void POP3_Analyzer::BeginData()
void POP3_Analyzer::BeginData(bool orig)
{
delete mail;
mail = new mime::MIME_Mail(this);
mail = new mime::MIME_Mail(this, orig);
}
void POP3_Analyzer::EndData()

2
src/analyzer/protocol/pop3/POP3.h
View file

@ -95,7 +95,7 @@ protected:
void NotAllowed(const char* cmd, const char* state);
void ProcessClientCmd();
void FinishClientCmd();
void BeginData();
void BeginData(bool orig);
void ProcessData(int length, const char* line);
void EndData();
void StartTLS();

24
src/analyzer/protocol/smtp/SMTP.cc
View file

@ -45,7 +45,7 @@ SMTP_Analyzer::SMTP_Analyzer(Connection* conn)
orig_is_sender = true;
line_after_gap = 0;
mail = 0;
UpdateState(first_cmd, 0);
UpdateState(first_cmd, 0, true);
cl_orig = new tcp::ContentLine_Analyzer(conn, true);
cl_orig->SetIsNULSensitive(true);
cl_orig->SetSkipPartial(true);
@ -214,7 +214,7 @@ void SMTP_Analyzer::ProcessLine(int length, const char* line, bool orig)
// but are now processing packets sent
// afterwards (because, e.g., the RST was
// dropped or ignored).
BeginData();
BeginData(orig);
ProcessData(data_len, line);
@ -264,7 +264,7 @@ void SMTP_Analyzer::ProcessLine(int length, const char* line, bool orig)
// RequestEvent() in different orders for the
// two commands.
if ( cmd_code == SMTP_CMD_END_OF_DATA )
UpdateState(cmd_code, 0);
UpdateState(cmd_code, 0, orig);
if ( smtp_request )
{
@ -273,7 +273,7 @@ void SMTP_Analyzer::ProcessLine(int length, const char* line, bool orig)
}
if ( cmd_code != SMTP_CMD_END_OF_DATA )
UpdateState(cmd_code, 0);
UpdateState(cmd_code, 0, orig);
}
}
@ -312,7 +312,7 @@ void SMTP_Analyzer::ProcessLine(int length, const char* line, bool orig)
if ( ! pending_reply && reply_code >= 0 )
// It is not a continuation.
NewReply(reply_code);
NewReply(reply_code, orig);
// Update pending_reply.
if ( reply_code >= 0 && length > 3 && line[3] == '-' )
@ -419,7 +419,7 @@ void SMTP_Analyzer::StartTLS()
// we want to understand the behavior of SMTP and check how far it may
// deviate from our knowledge.
void SMTP_Analyzer::NewReply(const int reply_code)
void SMTP_Analyzer::NewReply(const int reply_code, bool orig)
{
if ( state == SMTP_AFTER_GAP && reply_code > 0 )
{
@ -447,7 +447,7 @@ void SMTP_Analyzer::NewReply(const int reply_code)
pending_cmd_q.pop_front();
}
UpdateState(cmd_code, reply_code);
UpdateState(cmd_code, reply_code, orig);
}
// Note: reply_code == 0 means we haven't seen the reply, in which case we
@ -457,7 +457,7 @@ void SMTP_Analyzer::NewReply(const int reply_code)
// in the RPC), and as a result we have to update the state following
// the commands in addition to the replies.
void SMTP_Analyzer::UpdateState(const int cmd_code, const int reply_code)
void SMTP_Analyzer::UpdateState(const int cmd_code, const int reply_code, bool orig)
{
const int st = state;
@ -588,7 +588,7 @@ void SMTP_Analyzer::UpdateState(const int cmd_code, const int reply_code)
case 0:
if ( state != SMTP_RCPT_OK )
UnexpectedCommand(cmd_code, reply_code);
BeginData();
BeginData(orig);
break;
case 354:
@ -786,7 +786,7 @@ void SMTP_Analyzer::UpdateState(const int cmd_code, const int reply_code)
default:
if ( st == SMTP_GAP_RECOVERY && reply_code == 354 )
{
BeginData();
BeginData(orig);
}
break;
}
@ -890,7 +890,7 @@ void SMTP_Analyzer::ProcessData(int length, const char* line)
mail->Deliver(length, line, 1 /* trailing_CRLF */);
}
void SMTP_Analyzer::BeginData()
void SMTP_Analyzer::BeginData(bool orig)
{
state = SMTP_IN_DATA;
skip_data = 0; // reset the flag at the beginning of the mail
@ -901,7 +901,7 @@ void SMTP_Analyzer::BeginData()
delete mail;
}
mail = new mime::MIME_Mail(this);
mail = new mime::MIME_Mail(this, orig);
}
void SMTP_Analyzer::EndData()

6
src/analyzer/protocol/smtp/SMTP.h
View file

@ -58,13 +58,13 @@ protected:
void ProcessLine(int length, const char* line, bool orig);
void NewCmd(const int cmd_code);
void NewReply(const int reply_code);
void NewReply(const int reply_code, bool orig);
void ProcessExtension(int ext_len, const char* ext);
void ProcessData(int length, const char* line);
void UpdateState(const int cmd_code, const int reply_code);
void UpdateState(const int cmd_code, const int reply_code, bool orig);
void BeginData();
void BeginData(bool orig);
void EndData();
int ParseCmd(int cmd_len, const char* cmd);

11
src/analyzer/protocol/tcp/TCP_Endpoint.cc
View file

@ -201,13 +201,18 @@ int TCP_Endpoint::DataSent(double t, uint64 seq, int len, int caplen,
{
int status = 0;
if ( contents_processor && caplen >= len )
status = contents_processor->DataSent(t, seq, len, data);
if ( contents_processor )
{
if ( caplen >= len )
status = contents_processor->DataSent(t, seq, len, data);
else
TCP()->Weird("truncated_tcp_payload");
}
if ( caplen <= 0 )
return status;
if ( contents_file && ! contents_processor &&
if ( contents_file && ! contents_processor &&
seq + len > contents_start_seq )
{
int64 under_seq = contents_start_seq - seq;

3
src/analyzer/protocol/tcp/TCP_Reassembler.cc
View file

@ -42,6 +42,9 @@ TCP_Reassembler::TCP_Reassembler(analyzer::Analyzer* arg_dst_analyzer,
seq_to_skip = 0;
in_delivery = false;
if ( tcp_max_old_segments )
SetMaxOldBlocks(tcp_max_old_segments);
if ( tcp_contents )
{
// Val dst_port_val(ntohs(Conn()->RespPort()), TYPE_PORT);

74
src/analyzer/protocol/zip/ZIP.cc
View file

@ -22,10 +22,9 @@ ZIP_Analyzer::ZIP_Analyzer(Connection* conn, bool orig, Method arg_method)
zip->next_in = 0;
zip->avail_in = 0;
// "15" here means maximum compression. "32" is a gross overload
// hack that means "check it for whether it's a gzip file". Sheesh.
zip_status = inflateInit2(zip, 15 + 32);
if ( zip_status != Z_OK )
// "32" is a gross overload hack that means "check it
// for whether it's a gzip file". Sheesh.
if ( inflateInit2(zip, MAX_WBITS + 32) != Z_OK )
{
Weird("inflate_init_failed");
delete zip;
@ -56,38 +55,63 @@ void ZIP_Analyzer::DeliverStream(int len, const u_char* data, bool orig)
static unsigned int unzip_size = 4096;
Bytef unzipbuf[unzip_size];
int allow_restart = 1;
zip->next_in = (Bytef*) data;
zip->avail_in = len;
do
Bytef *orig_next_in = zip->next_in;
size_t orig_avail_in = zip->avail_in;
while ( true )
{
zip->next_out = unzipbuf;
zip->avail_out = unzip_size;
zip_status = inflate(zip, Z_SYNC_FLUSH);
if ( zip_status != Z_STREAM_END &&
zip_status != Z_OK &&
zip_status != Z_BUF_ERROR )
if ( zip_status == Z_STREAM_END ||
zip_status == Z_OK )
{
allow_restart = 0;
int have = unzip_size - zip->avail_out;
if ( have )
ForwardStream(have, unzipbuf, IsOrig());
if ( zip_status == Z_STREAM_END )
{
inflateEnd(zip);
return;
}
if ( zip->avail_in == 0 )
return;
}
else if ( allow_restart && zip_status == Z_DATA_ERROR )
{
// Some servers seem to not generate zlib headers,
// so this is an attempt to fix and continue anyway.
inflateEnd(zip);
if ( inflateInit2(zip, -MAX_WBITS) != Z_OK )
{
Weird("inflate_init_failed");
return;
}
zip->next_in = orig_next_in;
zip->avail_in = orig_avail_in;
allow_restart = 0;
continue;
}
else
{
Weird("inflate_failed");
inflateEnd(zip);
break;
return;
}
int have = unzip_size - zip->avail_out;
if ( have )
ForwardStream(have, unzipbuf, IsOrig());
if ( zip_status == Z_STREAM_END )
{
inflateEnd(zip);
delete zip;
zip = 0;
break;
}
zip_status = Z_OK;
}
while ( zip->avail_out == 0 );
}

25
src/broker/Manager.cc
View file

@ -24,6 +24,12 @@ int bro_broker::Manager::send_flags_self_idx;
int bro_broker::Manager::send_flags_peers_idx;
int bro_broker::Manager::send_flags_unsolicited_idx;
bro_broker::Manager::Manager()
: iosource::IOSource(), next_timestamp(-1)
{
SetIdle(true);
}
bro_broker::Manager::~Manager()
{
vector<decltype(data_stores)::key_type> stores_to_close;
@ -560,8 +566,10 @@ void bro_broker::Manager::GetFds(iosource::FD_Set* read, iosource::FD_Set* write
double bro_broker::Manager::NextTimestamp(double* local_network_time)
{
// TODO: do something better?
return timer_mgr->Time();
if ( next_timestamp < 0 )
next_timestamp = timer_mgr->Time();
return next_timestamp;
}
struct response_converter {
@ -619,7 +627,6 @@ static RecordVal* response_to_val(broker::store::response r)
void bro_broker::Manager::Process()
{
bool idle = true;
auto outgoing_connection_updates =
endpoint->outgoing_connection_status().want_pop();
auto incoming_connection_updates =
@ -630,8 +637,6 @@ void bro_broker::Manager::Process()
for ( auto& u : outgoing_connection_updates )
{
idle = false;
switch ( u.status ) {
case broker::outgoing_connection_status::tag::established:
if ( BrokerComm::outgoing_connection_established )
@ -677,8 +682,6 @@ void bro_broker::Manager::Process()
for ( auto& u : incoming_connection_updates )
{
idle = false;
switch ( u.status ) {
case broker::incoming_connection_status::tag::established:
if ( BrokerComm::incoming_connection_established )
@ -714,7 +717,6 @@ void bro_broker::Manager::Process()
continue;
ps.second.received += print_messages.size();
idle = false;
if ( ! BrokerComm::print_handler )
continue;
@ -751,7 +753,6 @@ void bro_broker::Manager::Process()
continue;
es.second.received += event_messages.size();
idle = false;
for ( auto& em : event_messages )
{
@ -822,7 +823,6 @@ void bro_broker::Manager::Process()
continue;
ls.second.received += log_messages.size();
idle = false;
for ( auto& lm : log_messages )
{
@ -890,7 +890,6 @@ void bro_broker::Manager::Process()
continue;
statistics.report_count += responses.size();
idle = false;
for ( auto& response : responses )
{
@ -940,8 +939,6 @@ void bro_broker::Manager::Process()
for ( auto& report : reports )
{
idle = false;
if ( report.size() < 2 )
{
reporter->Warning("got broker report msg of size %zu, expect 4",
@ -979,7 +976,7 @@ void bro_broker::Manager::Process()
}
}
SetIdle(idle);
next_timestamp = -1;
}
bool bro_broker::Manager::AddStore(StoreHandleVal* handle)

6
src/broker/Manager.h
View file

@ -50,6 +50,11 @@ class Manager : public iosource::IOSource {
friend class StoreHandleVal;
public:
/**
* Constructor.
*/
Manager();
/**
* Destructor. Any still-pending data store queries are aborted.
*/
@ -351,6 +356,7 @@ private:
std::unordered_set<StoreQueryCallback*> pending_queries;
Stats statistics;
double next_timestamp;
static VectorType* vector_of_data_type;
static EnumType* log_id_type;

3
src/event.bif
View file

@ -282,7 +282,8 @@ event packet_contents%(c: connection, contents: string%);
## reassembling a TCP stream, Bro buffers all payload until it sees the
## responder acking it. If during that time, the sender resends a chunk of
## payload but with different content than originally, this event will be
## raised.
## raised. In addition, if :bro:id:`tcp_max_old_segments` is larger than zero,
## mismatches with that older still-buffered data will likewise trigger the event.
##
## c: The connection showing the inconsistency.
##

8
src/file_analysis/analyzer/pe/pe-analyzer.pac
View file

@ -5,14 +5,14 @@
%}
%header{
VectorVal* process_rvas(const RVAS* rvas, const uint16 size);
VectorVal* process_rvas(const RVAS* rvas);
%}
%code{
VectorVal* process_rvas(const RVAS* rva_table, const uint16 size)
VectorVal* process_rvas(const RVAS* rva_table)
{
VectorVal* rvas = new VectorVal(internal_type("index_vec")->AsVectorType());
for ( uint16 i=0; i < size; ++i )
for ( uint16 i=0; i < rva_table->rvas()->size(); ++i )
rvas->Assign(i, new Val((*rva_table->rvas())[i]->size(), TYPE_COUNT));
return rvas;
@ -149,7 +149,7 @@ refine flow File += {
oh->Assign(21, new Val(${h.subsystem}, TYPE_COUNT));
oh->Assign(22, characteristics_to_bro(${h.dll_characteristics}, 16));
oh->Assign(23, process_rvas(${h.rvas}, ${h.number_of_rva_and_sizes}));
oh->Assign(23, process_rvas(${h.rvas}));
BifEvent::generate_pe_optional_header((analyzer::Analyzer *) connection()->bro_analyzer(),
connection()->bro_analyzer()->GetFile()->GetVal()->Ref(),

6
src/input/readers/sqlite/SQLite.h
View file

@ -1,7 +1,7 @@
// See the file "COPYING" in the main distribution directory for copyright.
#ifndef INPUT_READERS_POSTGRES_H
#define INPUT_READERS_POSTGRES_H
#ifndef INPUT_READERS_SQLITE_H
#define INPUT_READERS_SQLITE_H
#include "config.h"
@ -50,5 +50,5 @@ private:
}
}
#endif /* INPUT_READERS_POSTGRES_H */
#endif /* INPUT_READERS_SQLITE_H */

3
src/iosource/Manager.cc
View file

@ -118,9 +118,6 @@ IOSource* Manager::FindSoonest(double* ts)
src->Clear();
src->src->GetFds(&src->fd_read, &src->fd_write, &src->fd_except);
if ( src->fd_read.Empty() ) src->fd_read.Insert(0);
if ( src->fd_write.Empty() ) src->fd_write.Insert(0);
if ( src->fd_except.Empty() ) src->fd_except.Insert(0);
src->SetFds(&fd_read, &fd_write, &fd_except, &maxx);
}

12
src/iosource/PktSrc.cc
View file

@ -240,6 +240,18 @@ void PktSrc::GetFds(iosource::FD_Set* read, iosource::FD_Set* write,
if ( IsOpen() && props.selectable_fd >= 0 )
read->Insert(props.selectable_fd);
// TODO: This seems like a hack that should be removed, but doing so
// causes the main run loop to spin more frequently and increase cpu usage.
// See also commit 9cd85be308.
if ( read->Empty() )
read->Insert(0);
if ( write->Empty() )
write->Insert(0);
if ( except->Empty() )
except->Insert(0);
}
double PktSrc::NextTimestamp(double* local_network_time)

45
src/main.cc
View file

@ -179,8 +179,8 @@ void usage()
fprintf(stderr, " -r|--readfile <readfile> | read from given tcpdump file\n");
fprintf(stderr, " -s|--rulefile <rulefile> | read rules from given file\n");
fprintf(stderr, " -t|--tracefile <tracefile> | activate execution tracing\n");
fprintf(stderr, " -w|--writefile <writefile> | write to given tcpdump file\n");
fprintf(stderr, " -v|--version | print version and exit\n");
fprintf(stderr, " -w|--writefile <writefile> | write to given tcpdump file\n");
fprintf(stderr, " -x|--print-state <file.bst> | print contents of state file\n");
fprintf(stderr, " -z|--analyze <analysis> | run the specified policy file analysis\n");
#ifdef DEBUG
@ -188,6 +188,8 @@ void usage()
#endif
fprintf(stderr, " -C|--no-checksums | ignore checksums\n");
fprintf(stderr, " -F|--force-dns | force DNS\n");
fprintf(stderr, " -G|--load-seeds <file> | load seeds from given file\n");
fprintf(stderr, " -H|--save-seeds <file> | save seeds to given file\n");
fprintf(stderr, " -I|--print-id <ID name> | print out given ID\n");
fprintf(stderr, " -J|--set-seed <seed> | set the random number seed\n");
fprintf(stderr, " -K|--md5-hashkey <hashkey> | set key for MD5-keyed hashing\n");
@ -209,8 +211,6 @@ void usage()
fprintf(stderr, " -X <file.bst> | print contents of state file as XML\n");
#endif
fprintf(stderr, " --pseudo-realtime[=<speedup>] | enable pseudo-realtime for performance evaluation (default 1)\n");
fprintf(stderr, " --load-seeds <file> | load seeds from given file\n");
fprintf(stderr, " --save-seeds <file> | save seeds to given file\n");
#ifdef USE_IDMEF
fprintf(stderr, " -n|--idmef-dtd <idmef-msg.dtd> | specify path to IDMEF DTD file\n");
@ -547,7 +547,7 @@ int main(int argc, char** argv)
opterr = 0;
char opts[256];
safe_strncpy(opts, "B:e:f:I:i:J:K:n:p:R:r:s:T:t:U:w:x:X:z:CFNPSWabdghvQ",
safe_strncpy(opts, "B:e:f:G:H:I:i:J:K:n:p:R:r:s:T:t:U:w:x:X:z:CFNPQSWabdghv",
sizeof(opts));
#ifdef USE_PERFTOOLS_DEBUG
@ -582,6 +582,10 @@ int main(int argc, char** argv)
dump_cfg = true;
break;
case 'h':
usage();
break;
case 'i':
interfaces.append(optarg);
break;
@ -603,10 +607,19 @@ int main(int argc, char** argv)
g_trace_state.TraceOn();
break;
case 'v':
fprintf(stderr, "%s version %s\n", prog, bro_version());
exit(0);
break;
case 'w':
writefile = optarg;
break;
case 'x':
bst_file = optarg;
break;
case 'z':
if ( streq(optarg, "notice") )
do_notice_analysis = 1;
@ -617,6 +630,10 @@ int main(int argc, char** argv)
}
break;
case 'B':
debug_streams = optarg;
break;
case 'C':
override_ignore_checksums = 1;
break;
@ -688,13 +705,8 @@ int main(int argc, char** argv)
do_watchdog = 1;
break;
case 'h':
usage();
break;
case 'v':
fprintf(stderr, "%s version %s\n", prog, bro_version());
exit(0);
case 'X':
broxygen_config = optarg;
break;
#ifdef USE_PERFTOOLS_DEBUG
@ -707,9 +719,6 @@ int main(int argc, char** argv)
break;
#endif
case 'x':
bst_file = optarg;
break;
#if 0 // broken
case 'X':
bst_file = optarg;
@ -717,10 +726,6 @@ int main(int argc, char** argv)
break;
#endif
case 'X':
broxygen_config = optarg;
break;
#ifdef USE_IDMEF
case 'n':
fprintf(stderr, "Using IDMEF XML DTD from %s\n", optarg);
@ -728,10 +733,6 @@ int main(int argc, char** argv)
break;
#endif
case 'B':
debug_streams = optarg;
break;
case 0:
// This happens for long options that don't have
// a short-option equivalent.

2
src/strings.bif
View file

@ -700,7 +700,7 @@ function split_n%(str: string, re: pattern,
##
## Returns: An array of strings where, if *incl_sep* is true, each two
## successive elements correspond to a substring in *str* of the part
## not matching *re* (event-indexed) and the part that matches *re*
## not matching *re* (even-indexed) and the part that matches *re*
## (odd-indexed).
##
## .. bro:see:: split_string split_string1 split_string_all str_split

3
testing/btest/Baseline/broker.enable-and-exit/output Normal file
View file

@ -0,0 +1,3 @@
1
2
terminating

32
testing/btest/Baseline/core.reassembly/output Normal file
View file

@ -0,0 +1,32 @@
----------------------
flow weird, excessively_small_fragment, 164.1.123.163, 164.1.123.61
flow weird, fragment_size_inconsistency, 164.1.123.163, 164.1.123.61
flow weird, fragment_inconsistency, 164.1.123.163, 164.1.123.61
flow weird, fragment_inconsistency, 164.1.123.163, 164.1.123.61
flow weird, dns_unmatched_msg, 164.1.123.163, 164.1.123.61
----------------------
flow weird, excessively_small_fragment, 164.1.123.163, 164.1.123.61
flow weird, excessively_small_fragment, 164.1.123.163, 164.1.123.61
flow weird, fragment_overlap, 164.1.123.163, 164.1.123.61
----------------------
flow weird, fragment_with_DF, 210.54.213.247, 131.243.1.10
flow weird, fragment_with_DF, 210.54.213.247, 131.243.1.10
flow weird, fragment_with_DF, 210.54.213.247, 131.243.1.10
flow weird, fragment_with_DF, 210.54.213.247, 131.243.1.10
flow weird, fragment_with_DF, 210.54.213.247, 131.243.1.10
----------------------
flow weird, excessively_small_fragment, 128.32.46.142, 10.0.0.1
flow weird, excessively_small_fragment, 128.32.46.142, 10.0.0.1
flow weird, fragment_inconsistency, 128.32.46.142, 10.0.0.1
----------------------
net_weird, truncated_IP
net_weird, truncated_IP
net_weird, truncated_IP
net_weird, truncated_IP
rexmit_inconsistency, [orig_h=63.193.213.194, orig_p=2564/tcp, resp_h=128.3.97.175, resp_p=80/tcp], nlkmlpjfjjnoomfnqmdqgrdsgpefslhjrdjghsshrmosrkosidknnieiggpmnggelfhlkflfqojpjrsmeqghklmjlkdskjollmensjiqosemknoehellhlsspjfjpddfgqkemghskqosrksmkpsdomfoghllfokilshsisgpjhjoosidirlnmespjhdogdidoemejrnjjrookfrmiqllllqhlqfgolfqssfjrhrjhgfkpdnigiilrmnespjspeqjfedjhrkisjdhoofqdfeqnmihrelmildkngirkqorjslhmglripdojfedjjngjnpikoliqhdipgpshenekqiphmrsqmemghklodqnqoeggfkdqngrfollhjmddjreeghdqflohgrhqhelqsmdghgihpifpnikrddpmdfejhrhgfdfdlepmmhlhrnrslepqgmkopmdfogpoljeepqoemisfeksdeddiplnkfjddjioqhojlnmlirehidipdhqlddssssgpgikieeldsmfrkidpldsngdkidkoshkrofnonrrehghlmgmqshkedgpkpgjjkoneigsfjdlgjsngepfkndqoefqmsssrgegspromqepdpdeglmmegjljlmljeeorhhfmrohjeregpfshqjsqkekrihjdpfdjflgspepqjrqfemsjffmjfkhejdkrokmgdrhojgmgjpldjeiphroeheipolfmshoglkfnllfnhlflhlpddjflekhiqilefjpfqepdrrdokkjiekmelkhdpjlqjdlnfjemqdrksirdnjlrhrdijgqjhdqlidpfdisgrmnlfnsdlishlpfkshhglpdiqhpgmhpjdrpednjljfsqknsiqpfeqhlphgqdphflglpmqfkkhdjeodkelinkfpmfedidhphldmqjqggrljlhriehqqemeimkjhoqnsrdgengmgjokpeiijgrseppeoiflngggomdfjkndpqedhgnkiqlodkpjfkqoifidjmrdhhmglledkomllhpehdfjfdspmklkjdnhkdgpgqephfdfdrfplmepoegsekmrnikknelnprdpslmfkhghhooknieksjjhdeelidikndedijqqhfmphdondndpehmfoqelqigdpgioeljhedhfoeqlinriemqjigerkphgepqmiiidqlhriqioimpglonlsgomeloipndiihqqfiekkeriokrsjlmsjqiehqsrqkhdjlddjrrllirqkidqiggdrjpjirssgqepnqmhigfsqlekiqdddllnsjmroiofkieqnghddpjnhdjkfloilheljofddrkherkrieeoijrlfghiikmhpfdhekdjloejlmpperkgrhomedpfOOOOOOOOOOOOOOOOOOOOOOOOOOOO, nlkmlpjfjjnoomfnqmdqgrdsgpefslhjrdjghsshrmosrkosidknnieiggpmnggelfhlkflfqojpjrsmeqghklmjlkdskjollmensjiqosemknoehellhlsspjfjpddfgqkemghskqosrksmkpsdomfoghllfokilshsisgpjhjoosidirlnmespjhdogdidoemejrnjjrookfrmiqllllqhlqfgolfqssfjrhrjhgfkpdnigiilrmnespjspeqjfedjhrkisjdhoofqdfeqnmihrelmildkngirkqorjslhmglripdojfedjjngjnpikoliqhdipgpshenekqiphmrsqmemghklodqnqoeggfkdqngrfollhjmddjreeghdqflohgrhqhelqsmdghgihpifpnikrddpmdfejhrhgfdfdlepmmhlhrnrslepqgmkopmdfogpoljeepqoemisfeksdeddiplnkfjddjioqhojlnmlirehidipdhqlddssssgpgikieeldsmfrkidpldsngdkidkoshkrofnonrrehghlmgmqshkedgpkpgjjkoneigsfjdlgjsngepfkndqoefqmsssrgegspromqepdpdeglmmegjljlmljeeorhhfmrohjeregpfshqjsqkekrihjdpfdjflgspepqjrqfemsjffmjfkhejdkrokmgdrhojgmgjpldjeiphroeheipolfmshoglkfnllfnhlflhlpddjflekhiqilefjpfqepdrrdokkjiekmelkhdpjlqjdlnfjemqdrksirdnjlrhrdijgqjhdqlidpfdisgrmnlfnsdlishlpfkshhglpdiqhpgmhpjdrpednjljfsqknsiqpfeqhlphgqdphflglpmqfkkhdjeodkelinkfpmfedidhphldmqjqggrljlhriehqqemeimkjhoqnsrdgengmgjokpeiijgrseppeoiflngggomdfjkndpqedhgnkiqlodkpjfkqoifidjmrdhhmglledkomllhpehdfjfdspmklkjdnhkdgpgqephfdfdrfplmepoegsekmrnikknelnprdpslmfkhghhooknieksjjhdeelidikndedijqqhfmphdondndpehmfoqelqigdpgioeljhedhfoeqlinriemqjigerkphgepqmiiidqlhriqioimpglonlsgomeloipndiihqqfiekkeriokrsjlmsjqiehqsrqkhdjlddjrrllirqkidqiggdrjpjirssgqepnqmhigfsqlekiqdddllnsjmroiofkieqnghddpjnhdjkfloilheljofddrkherkrieeoijrlfghiikmhpfdhekdjloejlmpperkgrhomedpfqkrodjdmrqfpiodgphidfliidlhd
rexmit_inconsistency, [orig_h=63.193.213.194, orig_p=2564/tcp, resp_h=128.3.97.175, resp_p=80/tcp], dgphrodofqhq, orgmmpelofil
rexmit_inconsistency, [orig_h=63.193.213.194, orig_p=2564/tcp, resp_h=128.3.97.175, resp_p=80/tcp], lenhfdqhqfgs, dfpqssidkpdg
rexmit_inconsistency, [orig_h=63.193.213.194, orig_p=2564/tcp, resp_h=128.3.97.175, resp_p=80/tcp], nlkmlpjfjjnoomfnqmdqgrdsgpefslhjrdjghsshrmosrkosidknnieiggpmnggelfhlkflfqojpjrsmeqghklmjlkdskjollmensjiqosemknoehellhlsspjfjpddfgqkemghskqosrksmkpsdomfoghllfokilshsisgpjhjoosidirlnmespjhdogdidoemejrnjjrookfrmiqllllqhlqfgolfqssfjrhrjhgfkpdnigiilrmnespjspeqjfedjhrkisjdhoofqdfeqnmihrelmildkngirkqorjslhmglripdojfedjjngjnpikoliqhdipgpshenekqiphmrsqmemghklodqnqoeggfkdqngrfollhjmddjreeghdqflohgrhqhelqsmdghgihpifpnikrddpmdfejhrhgfdfdlepmmhlhrnrslepqgmkopmdfogpoljeepqoemisfeksdeddiplnkfjddjioqhojlnmlirehidipdhqlddssssgpgikieeldsmfrkidpldsngdkidkoshkrofnonrrehghlmgmqshkedgpkpgjjkoneigsfjdlgjsngepfkndqoefqmsssrgegspromqepdpdeglmmegjljlmljeeorhhfmrohjeregpfshqjsqkekrihjdpfdjflgspepqjrqfemsjffmjfkhejdkrokmgdrhojgmgjpldjeiphroeheipolfmshoglkfnllfnhlflhlpddjflekhiqilefjpfqepdrrdokkjiekmelkhdpjlqjdlnfjemqdrksirdnjlrhrdijgqjhdqlidpfdisgrmnlfnsdlishlpfkshhglpdiqhpgmhpjdrpednjljfsqknsiqpfeqhlphgqdphflglpmqfkkhdjeodkelinkfpmfedidhphldmqjqggrljlhriehqqemeimkjhoqnsrdgengmgjokpeiijgrseppeoiflngggomdfjkndpqedhgnkiqlodkpjfkqoifidjmrdhhmglledkomllhpehdfjfdspmklkjdnhkdgpgqephfdfdrfplmepoegsekmrnikknelnprdpslmfkhghhooknieksjjhdeelidikndedijqqhfmphdondndpehmfoqelqigdpgioeljhedhfoeqlinriemqjigerkphgepqmiiidqlhriqioimpglonlsgomeloipndiihqqfiekkeriokrsjlmsjqiehqsrqkhdjlddjrrllirqkidqiggdrjpjirssgqepnqmhigfsqlekiqdddllnsjmroiofkieqnghddpjnhdjkfloilheljofddrkherkrieeoijrlfghiikmhpfdhekdjloejlmpperkgrhomedpfOOOOOOOOOOOOOOOOOOOOOOOOOOOO, nlkmlpjfjjnoomfnqmdqgrdsgpefslhjrdjghsshrmosrkosidknnieiggpmnggelfhlkflfqojpjrsmeqghklmjlkdskjollmensjiqosemknoehellhlsspjfjpddfgqkemghskqosrksmkpsdomfoghllfokilshsisgpjhjoosidirlnmespjhdogdidoemejrnjjrookfrmiqllllqhlqfgolfqssfjrhrjhgfkpdnigiilrmnespjspeqjfedjhrkisjdhoofqdfeqnmihrelmildkngirkqorjslhmglripdojfedjjngjnpikoliqhdipgpshenekqiphmrsqmemghklodqnqoeggfkdqngrfollhjmddjreeghdqflohgrhqhelqsmdghgihpifpnikrddpmdfejhrhgfdfdlepmmhlhrnrslepqgmkopmdfogpoljeepqoemisfeksdeddiplnkfjddjioqhojlnmlirehidipdhqlddssssgpgikieeldsmfrkidpldsngdkidkoshkrofnonrrehghlmgmqshkedgpkpgjjkoneigsfjdlgjsngepfkndqoefqmsssrgegspromqepdpdeglmmegjljlmljeeorhhfmrohjeregpfshqjsqkekrihjdpfdjflgspepqjrqfemsjffmjfkhejdkrokmgdrhojgmgjpldjeiphroeheipolfmshoglkfnllfnhlflhlpddjflekhiqilefjpfqepdrrdokkjiekmelkhdpjlqjdlnfjemqdrksirdnjlrhrdijgqjhdqlidpfdisgrmnlfnsdlishlpfkshhglpdiqhpgmhpjdrpednjljfsqknsiqpfeqhlphgqdphflglpmqfkkhdjeodkelinkfpmfedidhphldmqjqggrljlhriehqqemeimkjhoqnsrdgengmgjokpeiijgrseppeoiflngggomdfjkndpqedhgnkiqlodkpjfkqoifidjmrdhhmglledkomllhpehdfjfdspmklkjdnhkdgpgqephfdfdrfplmepoegsekmrnikknelnprdpslmfkhghhooknieksjjhdeelidikndedijqqhfmphdondndpehmfoqelqigdpgioeljhedhfoeqlinriemqjigerkphgepqmiiidqlhriqioimpglonlsgomeloipndiihqqfiekkeriokrsjlmsjqiehqsrqkhdjlddjrrllirqkidqiggdrjpjirssgqepnqmhigfsqlekiqdddllnsjmroiofkieqnghddpjnhdjkfloilheljofddrkherkrieeoijrlfghiikmhpfdhekdjloejlmpperkgrhomedpfqkrodjdmrqfpiodgphidfliislrr
rexmit_inconsistency, [orig_h=63.193.213.194, orig_p=2564/tcp, resp_h=128.3.97.175, resp_p=80/tcp], iokgedlsdkjkiefgmeqkfjoh, ggdeolssksemrhedoledddml
net_weird, truncated_IP
rexmit_inconsistency, [orig_h=63.193.213.194, orig_p=2564/tcp, resp_h=128.3.97.175, resp_p=80/tcp], OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO HTTP/1.1\x0d\x0aHost: 127.0.0.1\x0d\x0aContent-Type: text/xml\x0d\x0aContent-length: 1\x0d\x0a\x0d\x0aO<?xml version="1.0"?>\x0d\x0a<g:searchrequest xmlns:g=, OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO HTTP/1.1\x0d\x0aHost: 127.0.0.1\x0d\x0aContent-Type: text/xml\x0d\x0aContent-length: 1\x0d\x0a\x0d\x0aO<?xml version="1.0"?igplqgeqsonkllfshdjplhjspmde

4
testing/btest/Baseline/core.tcp.quantum-insert/.stdout Normal file
View file

@ -0,0 +1,4 @@
----- rexmit_inconsistency -----
1429652006.683290 c: [orig_h=178.200.100.200, orig_p=39976/tcp, resp_h=96.126.98.124, resp_p=80/tcp]
1429652006.683290 t1: HTTP/1.1 200 OK\x0d\x0aContent-Length: 5\x0d\x0a\x0d\x0aBANG!
1429652006.683290 t2: HTTP/1.1 200 OK\x0d\x0aServer: nginx/1.4.4\x0d\x0aDate:

11
testing/btest/Baseline/scripts.base.protocols.http.missing-zlib-header/http.log Normal file
View file

@ -0,0 +1,11 @@
#separator \x09
#set_separator ,
#empty_field (empty)
#unset_field -
#path http
#open 2015-05-12-16-26-53
#fields ts uid id.orig_h id.orig_p id.resp_h id.resp_p trans_depth method host uri referrer user_agent request_body_len response_body_len status_code status_msg info_code info_msg filename tags username password proxied orig_fuids orig_mime_types resp_fuids resp_mime_types
#types time string addr port addr port count string string string string string count count count string count string string set[enum] string string set[string] vector[string] vector[string] vector[string] vector[string]
1232039472.314927 CXWv6p3arKYeMETxOg 237.244.174.255 1905 79.218.110.244 80 1 GET ads1.msn.com /library/dap.js http://zone.msn.com/en/root/default.htm Mozilla/4.0 (compatible; MSIE 7.0; Windows NT 5.1; .NET CLR 1.0.3705; .NET CLR 1.1.4322; Media Center PC 4.0; .NET CLR 2.0.50727) 0 13249 200 OK - - - (empty) - - - - - FBcNS3RwceOxW15xg text/plain
1232039472.446194 CXWv6p3arKYeMETxOg 237.244.174.255 1905 79.218.110.244 80 2 GET ads1.msn.com /library/dap.js http://zone.msn.com/en/root/default.htm Mozilla/4.0 (compatible; MSIE 7.0; Windows NT 5.1; .NET CLR 1.0.3705; .NET CLR 1.1.4322; Media Center PC 4.0; .NET CLR 2.0.50727) 0 13249 200 OK - - - (empty) - - - - - FDWU85N0DpedJPh93 text/plain
#close 2015-05-12-16-26-53

18
testing/btest/Baseline/scripts.base.protocols.modbus.events/conn.log Normal file
View file

@ -0,0 +1,18 @@
#separator \x09
#set_separator ,
#empty_field (empty)
#unset_field -
#path conn
#open 2015-06-19-21-05-46
#fields ts uid id.orig_h id.orig_p id.resp_h id.resp_p proto service duration orig_bytes resp_bytes conn_state local_orig local_resp missed_bytes history orig_pkts orig_ip_bytes resp_pkts resp_ip_bytes tunnel_parents
#types time string addr port addr port enum string interval count count string bool bool count string count count count count set[string]
1093521678.945447 CXWv6p3arKYeMETxOg 10.0.0.57 2387 10.0.0.3 502 tcp - 0.000493 0 0 SF - - 0 FafA 2 80 2 80 (empty)
1093521953.490353 CCvvfg3TEfuqmmG4bh 10.0.0.57 2579 10.0.0.8 502 tcp modbus 23.256631 24 0 SF - - 0 ShADaFf 6 272 5 208 (empty)
1093521681.696827 CjhGID4nQcgTWjvg4c 10.0.0.57 2578 10.0.0.3 502 tcp modbus 385.694948 112 138 S3 - - 0 ShADdf 20 920 12 626 (empty)
1093522326.102435 CsRx2w45OKnoww6xl4 10.0.0.9 3082 10.0.0.3 502 tcp modbus 177.095534 72 69 SF - - 0 ShADdFaf 16 720 9 437 (empty)
1093522946.554059 CRJuHdVW0XPVINV8a 10.0.0.57 2585 10.0.0.8 502 tcp - 76.561880 926 0 SF - - 0 ShADafF 8 1254 7 288 (empty)
1093523065.562221 CPbrpk1qSsw6ESzHV4 10.0.0.8 502 10.0.0.57 4446 tcp - 155.114237 128 0 SF - - 0 ShADaFf 16 776 15 608 (empty)
1153491879.610371 C6pKV8GSxOnSLghOa 192.168.66.235 2582 166.161.16.230 502 tcp - 2.905078 0 0 S0 - - 0 S 2 96 0 0 (empty)
1153491888.530306 CIPOse170MGiRM1Qf4 192.168.66.235 2582 166.161.16.230 502 tcp modbus 85.560847 1692 1278 S1 - - 0 ShADad 167 8380 181 8522 (empty)
1342774499.588269 C7XEbhP654jzLoe3a 10.1.1.234 51411 10.10.5.85 502 tcp modbus 2100.811351 237936 4121200 S2 - - 0 ShADdaF 39659 2300216 20100 5166412 (empty)
#close 2015-06-19-21-05-51

12
testing/btest/Baseline/scripts.base.protocols.smtp.attachment/files.log Normal file
View file

@ -0,0 +1,12 @@
#separator \x09
#set_separator ,
#empty_field (empty)
#unset_field -
#path files
#open 2015-06-02-01-46-30
#fields ts fuid tx_hosts rx_hosts conn_uids source depth analyzers mime_type filename duration local_orig is_orig seen_bytes total_bytes missing_bytes overflow_bytes timedout parent_fuid
#types time string set[addr] set[addr] set[string] string count set[string] string string interval bool bool count count count count bool string
1254722770.692743 Fel9gs4OtNEV6gUJZ5 10.10.1.4 74.53.140.153 CXWv6p3arKYeMETxOg SMTP 3 (empty) text/plain - 0.000000 - T 77 - 0 0 F -
1254722770.692743 Ft4M3f2yMvLlmwtbq9 10.10.1.4 74.53.140.153 CXWv6p3arKYeMETxOg SMTP 4 (empty) text/html - 0.000061 - T 1868 - 0 0 F -
1254722770.692804 FL9Y0d45OI4LpS6fmh 10.10.1.4 74.53.140.153 CXWv6p3arKYeMETxOg SMTP 5 (empty) text/plain NEWS.txt 1.165512 - T 10809 - 0 0 F -
#close 2015-06-02-01-46-31

10
testing/btest/Baseline/scripts.base.protocols.smtp.attachment/smtp.log Normal file
View file

@ -0,0 +1,10 @@
#separator \x09
#set_separator ,
#empty_field (empty)
#unset_field -
#path smtp
#open 2015-06-02-01-46-30
#fields ts uid id.orig_h id.orig_p id.resp_h id.resp_p trans_depth helo mailfrom rcptto date from to reply_to msg_id in_reply_to subject x_originating_ip first_received second_received last_reply path user_agent tls fuids
#types time string addr port addr port count string string set[string] string string set[string] string string string string addr string string string vector[addr] string bool vector[string]
1254722768.219663 CXWv6p3arKYeMETxOg 10.10.1.4 1470 74.53.140.153 25 1 GP <gurpartap@patriots.in> <raj_deol2002in@yahoo.co.in> Mon, 5 Oct 2009 11:36:07 +0530 "Gurpartap Singh" <gurpartap@patriots.in> <raj_deol2002in@yahoo.co.in> - <000301ca4581$ef9e57f0$cedb07d0$@in> - SMTP - - - 250 OK id=1Mugho-0003Dg-Un 74.53.140.153,10.10.1.4 Microsoft Office Outlook 12.0 F Fel9gs4OtNEV6gUJZ5,Ft4M3f2yMvLlmwtbq9,FL9Y0d45OI4LpS6fmh
#close 2015-06-02-01-46-31

11
testing/btest/Baseline/scripts.base.utils.urls/output Normal file
View file

@ -0,0 +1,11 @@
[scheme=https, netlocation=www.example.com, portnum=<uninitialized>, path=/, file_name=<uninitialized>, file_base=<uninitialized>, file_ext=<uninitialized>, params=<uninitialized>]
[scheme=http, netlocation=example.com, portnum=99, path=/test//, file_name=<uninitialized>, file_base=<uninitialized>, file_ext=<uninitialized>, params={
[foo] = bar
}]
[scheme=ftp, netlocation=1.2.3.4, portnum=<uninitialized>, path=/pub/files/something.exe, file_name=something.exe, file_base=something, file_ext=exe, params=<uninitialized>]
[scheme=http, netlocation=hyphen-example.com, portnum=<uninitialized>, path=/index.asp, file_name=index.asp, file_base=index, file_ext=asp, params={
[q] = 123
}]
[scheme=<uninitialized>, netlocation=dfasjdfasdfasdf, portnum=<uninitialized>, path=/, file_name=<uninitialized>, file_base=<uninitialized>, file_ext=<uninitialized>, params={
}]

36
testing/btest/Baseline/scripts.policy.misc.dump-events/all-events.log
View file

File diff suppressed because one or more lines are too long

BIN
testing/btest/Traces/http/missing-zlib-header.pcap Normal file
View file

Binary file not shown.

BIN
testing/btest/Traces/ipv4/fragmented-1.pcap Normal file
View file

Binary file not shown.

BIN
testing/btest/Traces/ipv4/fragmented-2.pcap Normal file
View file

Binary file not shown.

BIN
testing/btest/Traces/ipv4/fragmented-3.pcap Normal file
View file

Binary file not shown.

BIN
testing/btest/Traces/ipv4/fragmented-4.pcap Normal file
View file

Binary file not shown.

BIN
testing/btest/Traces/tcp/qi_internet_SYNACK_curl_jsonip.pcap Normal file
View file

Binary file not shown.

BIN
testing/btest/Traces/tcp/reassembly.pcap Normal file
View file

Binary file not shown.

19
testing/btest/broker/enable-and-exit.bro Normal file
View file

@ -0,0 +1,19 @@
# @TEST-REQUIRES: grep -q ENABLE_BROKER $BUILD/CMakeCache.txt
# @TEST-EXEC: bro -b %INPUT >output
# @TEST-EXEC: btest-diff output
redef exit_only_after_terminate = T;
event terminate_me() {
print "terminating";
terminate();
}
event bro_init() {
BrokerComm::enable();
print "1";
schedule 1sec { terminate_me() };
print "2";
}

10
testing/btest/core/leaks/smtp_attachment.test Normal file
View file

@ -0,0 +1,10 @@
# Needs perftools support.
#
# @TEST-REQUIRES: bro --help 2>&1 | grep -q mem-leaks
#
# @TEST-GROUP: leaks
#
# @TEST-EXEC: HEAP_CHECK_DUMP_DIRECTORY=. HEAPCHECK=local btest-bg-run bro bro -b -m -r $TRACES/smtp.trace %INPUT
# @TEST-EXEC: btest-bg-wait 60
@load base/protocols/smtp

26
testing/btest/core/reassembly.bro Normal file
View file

@ -0,0 +1,26 @@
# @TEST-EXEC: bro -C -r $TRACES/ipv4/fragmented-1.pcap %INPUT >>output
# @TEST-EXEC: bro -C -r $TRACES/ipv4/fragmented-2.pcap %INPUT >>output
# @TEST-EXEC: bro -C -r $TRACES/ipv4/fragmented-3.pcap %INPUT >>output
# @TEST-EXEC: bro -C -r $TRACES/ipv4/fragmented-4.pcap %INPUT >>output
# @TEST-EXEC: bro -C -r $TRACES/tcp/reassembly.pcap %INPUT >>output
# @TEST-EXEC: btest-diff output
event bro_init()
{
print "----------------------";
}
event flow_weird(name: string, src: addr, dst: addr)
{
print "flow weird", name, src, dst;
}
event net_weird(name: string)
{
print "net_weird", name;
}
event rexmit_inconsistency(c: connection, t1: string, t2: string)
{
print "rexmit_inconsistency", c$id, t1, t2 ;
}

12
testing/btest/core/tcp/quantum-insert.bro Normal file
View file

@ -0,0 +1,12 @@
# @TEST-EXEC: bro -b -r $TRACES/tcp/qi_internet_SYNACK_curl_jsonip.pcap %INPUT
# @TEST-EXEC: btest-diff .stdout
# Quantum Insert like attack, overlapping TCP packet with different content
redef tcp_max_old_segments = 10;
event rexmit_inconsistency(c: connection, t1: string, t2: string)
{
print "----- rexmit_inconsistency -----";
print fmt("%.6f c: %s", network_time(), c$id);
print fmt("%.6f t1: %s", network_time(), t1);
print fmt("%.6f t2: %s", network_time(), t2);
}

6
testing/btest/scripts/base/protocols/http/missing-zlib-header.bro Normal file
View file

@ -0,0 +1,6 @@
# This tests an issue where some web servers don't
# include an appropriate ZLIB header on deflated
# content.
#
# @TEST-EXEC: bro -r $TRACES/http/missing-zlib-header.pcap %INPUT
# @TEST-EXEC: btest-diff http.log

2
testing/btest/scripts/base/protocols/modbus/events.bro
View file

@ -5,6 +5,8 @@
# @TEST-EXEC: cat ${DIST}/src/analyzer/protocol/modbus/events.bif | grep "^event modbus_" | wc -l >total
# @TEST-EXEC: echo `cat covered` of `cat total` events triggered by trace >coverage
# @TEST-EXEC: btest-diff coverage
# @TEST-EXEC: btest-diff conn.log
event modbus_message(c: connection, headers: ModbusHeaders, is_orig: bool)
{

5
testing/btest/scripts/base/protocols/smtp/attachment.test Normal file
View file

@ -0,0 +1,5 @@
# @TEST-EXEC: bro -b -r $TRACES/smtp.trace %INPUT
# @TEST-EXEC: btest-diff smtp.log
# @TEST-EXEC: btest-diff files.log
@load base/protocols/smtp

19
testing/btest/scripts/base/utils/urls.test Normal file
View file

@ -0,0 +1,19 @@
# @TEST-EXEC: bro %INPUT >output
# @TEST-EXEC: btest-diff output
# This is loaded by default.
#@load base/utils/urls
print decompose_uri("https://www.example.com/");
print decompose_uri("http://example.com:99/test//?foo=bar");
print decompose_uri("ftp://1.2.3.4/pub/files/something.exe");
print decompose_uri("http://hyphen-example.com/index.asp?q=123");
# This is mostly undefined behavior but it doesn't give any
# reporter messages at least.
print decompose_uri("dfasjdfasdfasdf?asd");
# These aren't supported yet.
#print decompose_uri("mailto:foo@bar.com?subject=test!");
#print decompose_uri("http://example.com/?test=ampersand&amp;test");
#print decompose_uri("http://user:password@example.com/");

2
testing/external/subdir-btest.cfg vendored
View file

@ -19,3 +19,5 @@ DIST=%(testbase)s/../../..
BUILD=%(testbase)s/../../../build
BRO_PROFILER_FILE=%(testbase)s/.tmp/script-coverage.XXXXXX
BRO_DNS_FAKE=1
# For fedora 21 - they disable MD5 for certificate verification and need setting an environment variable to permit it.
OPENSSL_ENABLE_MD5_VERIFY=1